KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2482Help
Entry
AFE_2482          CDS       T00810                                 

Gene name
cga
Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFE_2482 (cga)
Enzymes [BR:afr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AFE_2482 (cga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2214225..2216270
Genome map
AA seq 681 aa AA seqDB search
MSELPFGQPGLPSTWASAHKQAVGTALSERSRVWFTVADGVLTEVYHPTIDCPNQRDLQF
LITDGGELFHEERRDLEHSVEWIEDGIPAFQIVSRDPQGRYRLIKTVCTDPDADCVLERV
HFEPLVEAARHYRLYLLWAPHLDNQGSDNHGRVEYGANECDWLIAWRGSRYAAVTATVPF
SRMSAGYVGHSDGWQDINRHRHLEWNFTTAGPGNIALTAELELPPDGHFMLCVGFGNSER
TAIKAASGCLDRNGFASVLNRYMEGWRAYQRGLLDLSAQSGDGGQLYRRSIAVLRTHIDK
IHRGAGVASLSIPWGESASADQPIGGYHLVWPRDLYHQAMGLLAAGDRERPAQILHYLFS
RQREDGSFFQNFWVDGRPYWQGLQLDEVGYSVLLANHLHHEGLLDFDPYPVVQRAADFLV
NHGPVTPQDRWEENRGYSPHTLAVVVAALRAAAAVADATGKGAQAVTYRQVAQDWEQRIE
DWTFTDCGRLLFGHPEHYERIALIPSVDTGEHLPECRVFLPIRNLPAEAMYNQSQCCVVD
GGFLELVRLGLRTAADLHVLKTLPVWDALCRRETPCGPAWYRYNGDGYGEHEDGSPFDGT
GRGRLWPLLTGERGHYEVAAGRDSRPYIKALECFANENGMLPEQVWDTEPRLGHGTGSAT
PLVWAHAEYIRLLGASSRKGT
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacttccgttcgggcagccaggcctgcccagcacttgggccagtgcccacaag
caggctgtgggcactgccttgagtgaacgttcccgcgtctggttcaccgtcgccgacggt
gtgttaaccgaggtttatcatccgacgatcgactgtccgaatcaacgcgatcttcagttc
ctgatcaccgatggtggtgagctatttcacgaagagcgacgcgatctggaacatagcgtc
gagtggatcgaagacggcattccggccttccagattgtcagccgagatccgcaaggccgc
taccgactgatcaagacggtctgcacggatcccgatgccgactgcgtgcttgagcgagtc
cacttcgagcctttggtggaagcagcccgacattaccgcctgtatctgctgtgggcgccc
catctcgacaaccaggggtcggataaccacggtcgcgttgaatatggcgccaacgaatgc
gactggctcatcgcctggcgcgggtctcgatacgctgcggtaaccgccacggtacccttc
tcacgcatgtcagccggctatgtgggtcattccgacggctggcaggatataaacagacac
cggcacctagaatggaacttcacgacagcgggaccgggcaatattgcgctgacggcagaa
ctggagttgccgccagacggtcatttcatgctttgtgtcgggttcggcaacagcgagcgg
acggccatcaaggctgcaagcggctgcctggaccgcaacggattcgcgtcggttctcaat
cgctacatggaagggtggcgcgcttatcagcgcggattgctcgatctgtcggcccagagc
ggcgacggcgggcagctttaccggcgtagcatcgcggtgttgcgtacgcatatcgacaag
attcatcgcggcgcgggcgtggcctcgttgtccattccctggggcgaatcggcatcggcg
gaccagccgattggcggctatcacttggtctggccgcgcgatctctaccaccaggccatg
ggcttgctcgccgccggcgaccgggagaggccagcgcagattctgcattatttgttctct
cgacagcgcgaggatggaagcttctttcagaatttctgggtggatggcaggccctactgg
caaggcctgcagctcgacgaagtcggctattcggtgctgttggccaaccacctgcaccac
gaagggctcttggacttcgacccgtatcccgtggtacagcgtgccgccgatttcctggtg
aaccatgggccggtcaccccccaggaccgctgggaggagaacagaggttacagtccccat
accctggcggtagtggttgccgcgctgcgcgctgcggcagcggtggccgatgcgaccgga
aaaggggcgcaggccgtcacttaccgacaggtggcgcaagactgggaacaacgcatcgag
gattggaccttcaccgattgcggtcgattgctcttcggccatcccgagcactacgagcgt
atcgccctgatcccgtcggtcgacaccggtgagcatctgccagagtgtcgagtatttctg
ccaattcgcaatctaccagcggaagcaatgtacaaccagtcccaatgttgcgtggtagac
ggcggtttcctggagttggtacgcctgggtctgcgcaccgccgccgacctgcacgttctc
aagaccctgccggtatgggatgcactgtgccgacgcgagacgccttgcggaccggcgtgg
tatcgctacaacggggatggttacggtgagcacgaggacggttcaccattcgatggtacc
gggcgcggacgcttgtggccgttgctcaccggcgagcgcggacactatgaagttgccgcc
ggacgcgactcccggccctacatcaaggcgctggagtgctttgccaacgaaaacggcatg
ctgcccgagcaagtgtgggatacagaaccgcgtctgggccatggcacgggttcggccaca
cctctggtgtgggctcacgcggagtatatccggctgctgggcgcttcgagtcgtaaagga
acatga

DBGET integrated database retrieval system