KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2633Help
Entry
AFE_2633          CDS       T00810                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFE_2633 (tpiA)
   01230 Biosynthesis of amino acids
    AFE_2633 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFE_2633 (tpiA)
   00051 Fructose and mannose metabolism
    AFE_2633 (tpiA)
   00562 Inositol phosphate metabolism
    AFE_2633 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AFE_2633 (tpiA)
Enzymes [BR:afr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AFE_2633 (tpiA)
Exosome [BR:afr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AFE_2633 (tpiA)
  Exosomal proteins of bladder cancer cells
   AFE_2633 (tpiA)
  Exosomal proteins of melanoma cells
   AFE_2633 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2337502..2338275)
Genome map
AA seq 257 aa AA seqDB search
MRPTMVAGNWKMNGLSGDAVHLTQAILHAGLEPMRPEVVIFPPFTLLHAVSQEAKSSALR
WGGQNLFWEASGAYTGEISGAMLRDMGCRYVLIGHSERRQIFAESDAQIVQKIKAALLSG
LIPVVCVGETEAERAQGLTDAVLRRQLEAVLPLLNLEASQPNLIIAYEPVWAIGTGLSAS
PEQAQAVHVFIRELAAAYSAQLARRLLLLYGGSVKGNNAAALFDQADIDGALVGGASLQA
GEFIQICRAAESAGRGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcccactatggtagcaggaaattggaagatgaacggcctgagtggggatgccgtg
catctcactcaggccattcttcacgcagggctggagccgatgcgcccggaggtggtgatc
ttcccgccttttaccctgctccacgcagtgtctcaggaggccaaaagcagcgccttgcgt
tggggggggcaaaaccttttctgggaagcaagcggcgcctataccggagaaatatccggg
gccatgctccgtgatatgggttgccgttatgtgctgatcgggcattccgagcggcggcag
atttttgcggagagcgacgcgcagattgtccagaagattaaagcagcattgctgtcaggt
ctcatccccgtggtttgcgtgggtgaaacagaggcggagcgtgcgcagggtctcacagat
gcggtattacgccgtcagctcgaagccgtgctgcccctgctgaatctcgaggcgagccaa
cccaacctgatcattgcctatgaacctgtttgggccattggcacaggtctgagtgccagc
cctgaacaggcacaggcggtccatgtgttcatccgcgagttggcagccgcttattcggcg
cagcttgccaggcgtctgttgctgctttatggcggaagtgttaaaggcaacaacgccgcc
gcgctttttgaccaggcggacattgacggggccctggtgggtggcgcgtccctgcaggcg
ggtgagtttatccaaatttgtcgtgctgccgagtcggcaggacgaggaggctga

DBGET integrated database retrieval system