KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2677Help
Entry
AFE_2677          CDS       T00810                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AFE_2677
Enzymes [BR:afr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     AFE_2677
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     AFE_2677
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     AFE_2677
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     AFE_2677
Glycosyltransferases [BR:afr01003]
 Polysaccharide
  Bacterial polysaccharide
   AFE_2677
Lipopolysaccharide biosynthesis proteins [BR:afr01005]
 Core region
  AFE_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2380239..2380808)
Genome map
AA seq 189 aa AA seqDB search
MDWCERFKEFRDRNRCIVYFPNLHEGEDAEAYGIFLSLMRVKMGIMVLAPDREERYEPVY
RDALKYHLQTIRHSRLFTSFVPIKTRVYFVETAEQRDAFYGCADFCVPGGTLTGGTVDLA
KAIAGGCPLILGPKMPDDAVRQGLLAAGAAVWAQDNAEIVDLAKAWLNDPAAARAAAEKA
KTWLGQRGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggattggtgcgaacgttttaaggagttccgggaccggaaccgttgcatagtgtacttc
cccaacctgcacgagggcgaagatgcagaggcctatgggatttttctctccctgatgcgg
gtgaagatggggatcatggtgctggcgccggatcgggaagaacgctacgaacccgtttat
cgggatgcgctgaaataccacctgcagaccattcgccacagccgactgttcaccagcttc
gtgcccatcaagacgcgcgtctactttgtggaaacggcggagcagcgcgatgccttctac
ggttgtgcggatttttgtgtgcccggcggcaccctgacgggcggcacggtggatctcgcc
aaagccatcgcgggtggttgtcccctcatcctcggtccgaaaatgccggatgacgccgta
cgtcagggcttgttggccgccggcgctgcggtatgggcgcaggataacgcggagattgtc
gatctggcgaaggcctggctgaacgatccggcagcggccagggcggcagcggagaaggcg
aagacctggttgggacagcgtggggcttag

DBGET integrated database retrieval system