KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2677Help
Entry
AFE_2677          CDS       T00810                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:afr00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2380239..2380808)
Genome map
AA seq 189 aa AA seqDB search
MDWCERFKEFRDRNRCIVYFPNLHEGEDAEAYGIFLSLMRVKMGIMVLAPDREERYEPVY
RDALKYHLQTIRHSRLFTSFVPIKTRVYFVETAEQRDAFYGCADFCVPGGTLTGGTVDLA
KAIAGGCPLILGPKMPDDAVRQGLLAAGAAVWAQDNAEIVDLAKAWLNDPAAARAAAEKA
KTWLGQRGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggattggtgcgaacgttttaaggagttccgggaccggaaccgttgcatagtgtacttc
cccaacctgcacgagggcgaagatgcagaggcctatgggatttttctctccctgatgcgg
gtgaagatggggatcatggtgctggcgccggatcgggaagaacgctacgaacccgtttat
cgggatgcgctgaaataccacctgcagaccattcgccacagccgactgttcaccagcttc
gtgcccatcaagacgcgcgtctactttgtggaaacggcggagcagcgcgatgccttctac
ggttgtgcggatttttgtgtgcccggcggcaccctgacgggcggcacggtggatctcgcc
aaagccatcgcgggtggttgtcccctcatcctcggtccgaaaatgccggatgacgccgta
cgtcagggcttgttggccgccggcgctgcggtatgggcgcaggataacgcggagattgtc
gatctggcgaaggcctggctgaacgatccggcagcggccagggcggcagcggagaaggcg
aagacctggttgggacagcgtggggcttag

DBGET integrated database retrieval system