KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_2973Help
Entry
AFE_2973          CDS       T00810                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:afr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2663162..2663998
Genome map
AA seq 278 aa AA seqDB search
MERIIAIAKEAGDAIMEIYQRDFTVDYKEDSSPLTDADRAAHGIILHGLHALYPEIPFLS
EEGDAIPYEIRKHWGFFWLVDPLDGTKEFIRKNGEYTVNIALIENNRPVLGVVYAPALDL
MYYAKEGAGAWRQDAVQGTQKLPLHVNDSREQKLTVVASKSHRSPETEVYIDELRKSTRE
LEVVSIGSSLKICLVAEGDADCYPRLGPTMEWDTAAAQIIATESGCRVEAAAGGHKLIYN
KKDLLNPYFVVETAVAMFCNGRTVANTRGYEHEPTSDQ
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaattattgccatcgccaaagaagccggcgatgccatcatggaaatttatcaa
cgggattttacggtggattacaaggaggactcctcccccctcacggatgccgatcgtgcc
gcacatgggatcattctccatggccttcatgccctttatccggagattccgtttttgtcg
gaagagggtgatgccattccttatgagatacggaaacactggggctttttctggctggtg
gatcccttggatggtacaaaagagttcatccggaaaaatggcgaatataccgtaaacatc
gcgctgatcgaaaacaacaggccggtgctcggtgtggtttacgccccggcgctggatctc
atgtactacgcaaaagagggagcaggggcatggcgccaagatgcagtacaggggacccaa
aagcttccgttgcatgtcaatgatagtcgggaacagaagctgacggtggtggcgagcaaa
tcccatcgatcgcccgagacggaagtctatatcgacgagcttcgaaaatccacgcgggaa
ctcgaggtcgtttcgattggcagttcgctcaagatctgcctcgtcgccgagggggatgcg
gattgttatccccgcttggggccaaccatggaatgggatacggcggcggcccagattatt
gcgaccgaaagcggctgtagagtagaggctgccgctggcggacataaactaatatataac
aaaaaagatttattaaatccctattttgttgttgaaacagcggtcgccatgttttgcaac
ggccggacggtggcaaacacgagagggtatgaacatgaaccgacttctgatcaatga

DBGET integrated database retrieval system