KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3039Help
Entry
AFE_3039          CDS       T00810                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:afr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2729645..2730916
Genome map
AA seq 423 aa AA seqDB search
MDKLLLRGNGPLRGELRISGAKNAALPCLAATLLAREPVRLCNIPHLRDITTTLELLSTL
GARVLVDGQLGIEVDPRPVHSVVAPYELVKTMRASILVLGPLLARHGSAEVSLPGGCAIG
SRPVSVHLSGLQALGAEITVEDGFVKAQAARLRGTRIVMEMVSVTGTENLLMAATLAEGR
TILENAAREPEIVDLARCLSAMGARISGAGTSVIEIEGVAELHGAEHSVVPDRIETGTYL
VAAAMTGGDICLKRTDAGLLESVLLKLKEAGAEVTTGADTIRIRMKRRPRAVDVRTAPFP
AFPTDMQAQFMAMNCIAEGSSVVTETIFENRFMHVSELQRLGADINADGKTAVVRGVQRL
RGAPVMATDLRASASLVLAGLVAEGETLIDRIYHLDRGYEVIEEKLSALGADIRRISNTR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataagctgctgctgcgtggcaatggccccctgcgtggtgagttgcggatttccggg
gccaaaaacgcggccttgccctgtctcgctgccaccctgctggcgcgggagccggtgcgg
ctgtgcaatattccgcatctgcgggacatcaccacgaccctggagttgttgagcacgctc
ggtgcaagggtactggtggacggccagctcgggatcgaagtcgatccacgcccggtacat
tcggtggtcgctccttatgaactggtgaagaccatgcgggcctcgatactggttctcggg
ccattgctggcccgacacggatcggcagaagtgagcctgcccggtggctgtgccatcggc
agccgcccggtgagtgtccatctcagcggcctgcaggcgttgggtgccgaaatcaccgta
gaggacggtttcgttaaagcgcaggcagcacgcctgcgcggcacgcgcatcgttatggag
atggtctccgtcaccggtacggaaaacctgctcatggcagccaccctcgccgaggggcgc
accatcctggaaaatgccgcccgcgaaccggaaatcgtcgatctcgcccgttgtctgtcc
gccatgggtgcgcgcatttccggggccggaacgtcggtcatcgagatcgagggcgtggcg
gagctgcatggcgccgaacacagtgttgtgcccgaccgcatcgagaccggtacgtacctg
gtggctgcggccatgactggcggcgacatctgcctcaaacgcaccgacgcgggcctgctg
gagagcgtcctcctcaaactgaaggaagcaggggccgaggtcacgaccggggcagacacg
atccgcatccgcatgaaacggcggccacgggcagtggatgtccgcactgcgccctttccg
gccttccccacggacatgcaggcgcagttcatggcgatgaactgcattgccgaagggagc
agcgtcgtcaccgaaaccatcttcgagaatcgcttcatgcacgtttccgagttgcaacgg
ctgggtgccgacatcaatgccgatggcaaaaccgccgtggtgcggggggtacagcgtttg
cgcggcgcccccgtgatggcaaccgatctgcgggcatcggcgtcgctggtcctggccggt
ctggtggcggagggcgaaaccctcatcgaccgcatctatcatctggatcgtggctacgag
gtcatcgaagagaagctcagcgccctcggtgcagatatccgccggataagcaacaccagg
agtgtcgcatga

DBGET integrated database retrieval system