KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3191Help
Entry
AFE_3191          CDS       T00810                                 

Definition
type III restriction-modification system, Res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
Enzymes [BR:afr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     AFE_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2865496..2868222
Genome map
AA seq 908 aa AA seqDB search
MALHPNFPRSPYEVLPPDLRWFPAAEELRSTAYEKLLPPLVAKVREEVKAWRDTDYAGAS
STSRALLAWWFETSHMIEQADGTQNQFRYYFAQREAVETVIWLYEVRGARDKFDLLRFDA
SGAVSANMFDEAWPRFVVKMATGAGKTKVLSLLIAWSYFHKLYEADSTLARNFLLIAPNI
IVLDRLRADFDGLRIFFNDPVLPDNGHAGHNWRDDFQMALHIQDDVRIVRPTGNLFLTNI
HRVYLGEVTEPSLEDDDLRDYFLAPFGAKPVGKTTDSNTDLGEIVREIDELAVFNDEAHH
IHDSRLAWFQCIQDIHHKLLQKDLHLAIQVDVTATPRHDNGAIFVQTVSDYPLVEAIAQN
VVKHPVLPDAASRAKLEEHKSPIISEKYADYLTLGIEEWRKSYAEHEKLGKKAVLFVMVD
DTKNCDEVGSHLERICPELQGAVLVIHTKNNGEISEAASGKSKEDLELLRKQSNEIDTWK
SPYKAIVSVLMLKEGWDVRNVTTIVGLRAYAAKSNILPEQTLGRGLRRMYFGSDQRETVS
VMGTPAFMDFVESIQNEGVTFDRVPMGGAGGRQRQDSLVVEVETESPDKNIDELDITVPR
LTRRYNREFKDLTELEPEHFGNPKLPIKAFTPEETREIVFKTMLEGEVDHTMQLDGSGPG
DYRSVVAFFARQLLKDLRLVGGYDQLYPKVRSFLRDHLFTQPVDLEDPVILRNLSEPEVG
KLVFDHFRAAINALTIYEGGSSRIDGHIRLRDTRPFRTEPRDFVQAKKSVFNRIVGEANA
GGLELAFAAFLEAAPDVRAFGKNYMAVGFKIEYVKANGELSTYTPDFIVRISNGEVWIVE
TKGREELDLPQKMARLRQWCEDATEASKDDGGPSYHFVYVDQEGFEQHKPSTFAGLASVF
REYQDEGR
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcacccgaatttcccacgctctccctacgaggtattgcccccagacctgcgc
tggttcccggcagcggaagaactacgcagtacagcttatgaaaagctgctgcctccactg
gtcgcgaaagtacgggaagaggtaaaagcatggcgcgatactgactatgcgggcgcctcg
tcaacgtcacgcgcactgctggcttggtggttcgagaccagccatatgatcgaacaagca
gacggcacacaaaaccagttccgctactacttcgcgcagcgcgaagcggtcgaaaccgtc
atctggctctatgaggtgcgcggcgcgcgcgacaagttcgacctgctgcgtttcgacgcc
tctggcgccgtgtcggccaatatgttcgatgaggcgtggccgcgcttcgtggtcaagatg
gccactggtgcgggcaagaccaaggtgctgtcgctgctgatcgcctggagctactttcac
aagctctatgaggcggattcgacgttggcgcgcaacttcctgctgatcgcgcccaacatc
atcgtgctcgaccgcctgcgcgccgatttcgacgggctgcgcatcttcttcaatgatcct
gtgctgcccgacaatggccatgccggccacaactggcgcgacgatttccagatggccctg
cacatccaggacgacgtgcgcatcgttcggccgaccggtaatctttttctgaccaacatc
caccgggtctatctcggcgaggtgaccgagccctcgctggaggatgatgacctgcgcgat
tacttcctcgcgccgttcggtgccaagcccgtcggcaagaccactgacagcaacaccgac
ttgggcgaaatcgtgcgcgagattgatgaactcgccgtgttcaacgacgaggcgcaccac
atccacgacagccgcctggcatggttccagtgcatccaggacattcaccacaagctgcta
cagaaagacctgcacttggcgatccaggtggacgtgacggccacgccgcgccacgacaat
ggcgcgatcttcgtgcagaccgtgagcgactaccccctggtcgaggccatcgcccagaac
gtggtcaagcaccccgtgctgccggatgcggccagccgggcaaagctggaggagcacaag
agcccgatcatctccgaaaaatatgccgactacctcactctgggcatcgaggaatggcgc
aagagctacgccgaacacgagaagctgggcaagaaggcggtgttgttcgtcatggtggac
gacaccaaaaactgcgacgaagtgggcagtcacctggagcggatttgcccggagctacag
ggagcggtgctggtaatccacaccaagaacaacggcgagatttccgaggcggcctccggc
aagagcaaggaagatctggagttgctgcgcaagcagtccaatgaaatcgacacctggaaa
tcgccctacaaggcgattgtctcggtgctgatgctcaaggaaggctgggacgtgcgcaac
gtcaccaccatcgttggcctgcgcgcctatgccgccaagagcaacatcctgccggaacag
accctcgggcgcggcttgcgccgcatgtatttcggcagcgaccagcgcgagaccgtctcg
gtgatgggcacgccggctttcatggattttgtggaatccatccagaacgagggcgtcacc
tttgaccgtgtgccgatgggcggcgccggtggacggcaacggcaagattctctggttgtc
gaggtcgaaaccgaatcgcccgacaagaacatcgacgaactcgacatcacggtgccgcgc
ctgacccggcgctacaaccgggaattcaaagacctgaccgagctggagccggaacacttc
ggcaacccgaagctgccgatcaaggccttcacgccggaagaaacccgcgagattgtcttc
aagaccatgctcgaaggcgaggtcgatcacaccatgcaattggatggcagcgggccaggc
gattaccgctccgtggtggcgtttttcgcgaggcaactcctcaaggacttgcgccttgtc
ggcggttacgaccagctctatcccaaggtcagatccttccttcgcgaccacctcttcact
cagccggtcgatctggaagacccggtgatcctgcgcaacctgtccgaaccggaagtcggc
aagctggtgttcgatcatttccgcgccgcgatcaacgccctgacgatctacgaaggcggc
agctcgcgcatcgacggtcatatccggcttcgggacacccggcctttccgaaccgagccg
cgcgacttcgtgcaggcaaagaagtcggtattcaaccgcatcgtcggcgaagccaacgcg
ggcggccttgagctggcctttgccgcgttcctggaggctgcgcccgacgtgcgggccttc
ggcaagaactacatggccgtgggcttcaagatcgaatacgtcaaagccaacggcgagttg
tccacctacacgccggatttcattgtgcgcatcagcaacggcgaggtctggatcgtcgag
accaaaggccgcgaagaactcgacctgccgcagaaaatggcccgcctgcggcagtggtgc
gaggacgccaccgaagcgagcaaggacgacggcgggccgagttaccacttcgtctatgtc
gatcaggagggcttcgagcagcacaagccctcgacgttcgcgggcttggccagcgtattc
cgtgaataccaagacgagggccgctga

DBGET integrated database retrieval system