KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_3299Help
Entry
AFE_3299          CDS       T00810                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFE_3299 (hemD)
Enzymes [BR:afr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AFE_3299 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2973994..2974782)
Genome map
AA seq 262 aa AA seqDB search
MNSTILRGKGIVVTRPRAQTGEMLTLLEAQGARPILFPAVEIEAPENWQSLDDALHRLVT
YDWVIFSSRNAVAFALSRLQSRNLSWPVGPRIAAVGRETAKALGEFGLQVDLVPRRFSSE
GLLESPELLDVRGQRIALFAGDQGRELLEKTLDERGAVTDEVLCYRRRLPGTNPTPLLHA
WARGELDAVTVTSPEIFNNFYQMVGGLGQRWLKNTPIIAISPLTAEAVTAVGLPTPWIAP
EASTAGMLAALTVWAQGLAPHT
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaccatactgcgcggcaagggcatcgtggttacccggccgcgcgcgcagacc
ggcgagatgctgaccctgttggaggcgcaaggcgcgcgccccatactgtttcccgccgta
gagatcgaggcgccggagaactggcaatccctggatgacgccttgcatcggcttgtgacg
tatgactgggtgattttttccagccgtaatgcggtcgccttcgccctcagtcgcctgcag
agccgcaacctgtcctggccggtggggccgcgcattgcggcggtgggacgggagaccgcc
aaggcgttgggtgagtttggtctgcaggtcgacctggtcccccggcgtttcagctccgag
ggtttgctggaaagtcccgaactgctggacgtgcgtgggcagcgcatcgcgctgtttgcc
ggtgatcagggccgggagctgctggagaagaccctggatgagcggggagccgtcaccgac
gaggtgctctgctaccggcgccggttgcccggcaccaacccgacgccgttgctgcatgcc
tgggcgcgcggcgagctggatgcggtcaccgtgaccagcccggagatcttcaataatttc
tatcagatggtggggggactgggacaacgctggttgaaaaacacgcccatcatcgccatc
agccccctcaccgccgaggccgtcaccgcggtcggtctgcccaccccctggatcgccccg
gaagccagtacggctggcatgctggcggcgctgacggtatgggcgcaaggcctggcgcct
cacacatga

DBGET integrated database retrieval system