KEGG   Actinoplanes friuliensis: AFR_03795Help
Entry
AFR_03795         CDS       T02892                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afs  Actinoplanes friuliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847194..848288
Genome map
AA seq 364 aa AA seqDB search
MAVLATSTLLGPGLQPAQAATPAGSHLSNVPLRWAAPHDLRIGTAVAGGGHHLEQDYPDP
FTYDKPYRKVLAREFNSVSPENQMKWEFIHPERGQYNFGPADAIVKFARQHGQVVRGHTL
LWHSQNPAWLEEGTFTKAQLRAILKDHITTVVGRYRGKIQQWDVANEIFNENGEYRQENI
FIRELGPSIVEDAFRWAHRADPKAQLFLNDYGVDWPGVKVDAYEALAKQLLADRVPLHGF
ASQAHLSMRYGAPDQLQAVLQRFDDLGLYTAITELDVRMDLPEGGVPTAEQLQTQATYYK
TVLDACLAVADCNSFTIWGFTDKYSWVPVFFPSEGAATVMGNNFERKPAYYALRNTLAAA
RHNR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcctcgccacctcgactctgctcggccccggcctccagcctgcgcaggcggca
acgccggccggcagccacctgtccaatgtgccactgcgctgggcggcgccacatgacctg
cgcatcggcaccgcggtcgccggcggtggtcatcacctcgaacaggactacccggacccg
ttcacgtacgacaagccgtaccggaaagtcctggcccgggaattcaattcggtctccccg
gaaaaccagatgaagtgggagttcatccaccccgaacgcggccagtacaacttcggcccg
gccgacgccatcgtcaagttcgcccgccagcacggccaggtcgtccgcggccacacgctg
ctctggcacagccagaacccggcatggctcgaagagggcaccttcaccaaggcgcaactc
cgcgcaatcctgaaggaccacatcaccacggttgtcggccgttaccgcggcaaaatccag
cagtgggacgtcgccaacgaaatcttcaacgagaacggcgagtaccgccaggaaaacatc
ttcatccgcgaactcggcccgagcatcgtcgaagacgccttccgctgggcccaccgcgcc
gaccccaaagcccaactattcctgaacgactacggcgtggattggcctggtgtaaaggtc
gacgcgtacgaagcgctggccaagcagctgctggcggaccgtgtgccactgcacggcttc
gcgtctcaggcccacttgagcatgcgctacggcgcacctgaccagctgcaggctgtgctc
cagcgcttcgacgacctcggcttgtacacggcaatcaccgagctcgacgtgcgcatggac
ctgcccgagggtggcgtgccgaccgccgagcagctgcagacgcaggccacctattacaag
acggtgctggacgcgtgcctggccgtcgccgactgcaactccttcaccatctggggcttc
accgacaagtacagctgggtcccggtgttcttcccctccgagggagccgcaacggtgatg
ggcaacaacttcgaacgcaagcccgcgtactacgccctgcgcaacacgctggccgcagca
cgccacaaccgctga

DBGET integrated database retrieval system