KEGG   Actinoplanes friuliensis: AFR_17565Help
Entry
AFR_17565         CDS       T02892                                 

Definition
putative pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
afs  Actinoplanes friuliensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFR_17565
   00500 Starch and sucrose metabolism
    AFR_17565
Enzymes [BR:afs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AFR_17565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3794488..3795633
Genome map
AA seq 381 aa AA seqDB search
MHRRTLIRLAATSGAAVAAGLATGRSAQARPGGPTTADGFPGQAHPGGRVAADGLPGPAH
PGRRITVAADGSGDVTTVQAAIDAVPSGNTTCFTIDVRPGVYTGQVIVPADKPHVLLRGR
ATRAEQVVISDDRANGTPRPEGGTWGTSGSASVTVDASDFTATNLTFANTFDEAAHPEIT
GRQAVAVLTRADRLVFDHVRFLGNQDTLYLNSPAADVPARIYLRGCYVEGDVDFIFGRGT
AAFDRCRIHSLTRGSETNNGYVTAPSTSITNPYGLLFSRCSFASDAPAASVFLGRPWHPS
QDPNAIGQAVIRNSVLGAHIGPAPWSDFGTWSWRDARFAEFRNRGPGALVTPDRPQLTAA
EATGYTVASYLAGTDGWSPHC
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgccgcaccttgatccggctggccgcgacctccggcgccgcggtggccgccggc
cttgccaccggccgttccgcgcaggcccgtccaggcgggccgaccacagccgacggcttt
cccgggcaggcccacccaggcgggcgggtcgcggccgacggccttcccgggccggcccac
ccgggccggcggatcacggtcgcggccgacggcagcggtgacgtcacgaccgtccaggcc
gcgatcgacgcggtgccatccgggaacaccacctgcttcacgatcgacgtgcggccgggt
gtctacaccgggcaggtcatcgttccggcggacaagccgcacgtcctgctgcgcggccgg
gccacccgtgcggagcaggtggtcatcagcgacgaccgcgccaacggcaccccgcgcccc
gaaggtggcacgtggggcacctcgggcagcgcctcggtcaccgtcgacgcctcggatttc
actgccacgaacctgacgttcgccaacaccttcgacgaggccgcccacccggagatcacc
ggcaggcaggcggtggcggtgctgacccgcgctgatcggctcgttttcgatcacgtccgg
ttcctcggcaaccaggacacgctctacctcaacagtccggccgcggacgtacccgcccgg
atctacctgcgtggctgttacgtcgagggtgacgtcgacttcatcttcggccgtggcacg
gccgccttcgaccgctgccggatccactcgctgacccgcggatccgagaccaacaacgga
tacgtgaccgcgccgagcacgagcatcaccaacccgtacgggctgctcttctcacgctgc
tcgttcgcctccgacgcacccgcggcgagtgtcttcctcgggcggccgtggcatccgagc
caggacccgaacgcgatcgggcaggcggtgatccggaactcggtgctcggcgcgcacatc
ggcccggcgccgtggagcgacttcggcacctggtcgtggcgtgacgcgcggttcgcggag
ttccgcaaccgcggccccggcgcgctggtgaccccggaccgcccgcaactcaccgccgcc
gaggccaccggctacaccgtcgcgtcctacctggccggcaccgacggctggtcaccgcac
tgctga

DBGET integrated database retrieval system