KEGG   Actinoplanes friuliensis: AFR_18005Help
Entry
AFR_18005         CDS       T02892                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afs  Actinoplanes friuliensis
Brite
Enzymes [BR:afs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AFR_18005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3894721..3895803)
Genome map
AA seq 360 aa AA seqDB search
MRVHKAWSAAALASLALLAGSPAVAAEDPAAAAVKPASPREQSLRVLADRAGVRIGTAVD
TTALAADAPYRETIEREFSSVTPENVMKWQLVEPQQGVYDWAAADRLVDFARANGQTVRG
HTLVWHSQNPDWLTEDAFTPAQLRALLRKHVIDQVTHFKGRIWHWDVANEIFNDDGTWRD
TIWLRNLGKGYVADAFRWARQADPQAKLFLNDYNNEGVNAKSDAYYRLVRELKAQRVPVD
GYGIQGHLAVQYGVPGDTLANLRRFEALGLQTAFTEVDVRMPLPADPIKVQAQAQGFTAL
LQACLLARRCVSYTLWGFTDRYSWVPDVFDGEGSATPLDADLVPKPAWFAMRDTLTLAGR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagagtccacaaagcttggagcgcggccgctctggcctcgctcgccctgctggccggc
tcccccgccgtggcggcggaggacccggcggcggctgccgtgaagcccgcctcgccgcgc
gaacaaagtctgcgggtcctcgccgaccgcgccggggtgcgcatcgggaccgcggtcgac
acgacggctctggccgccgacgccccctaccgtgagaccatcgagcgcgagttcagctcg
gtgacgcccgagaacgtcatgaagtggcagctcgtcgagccccagcagggtgtctacgac
tgggcggccgccgaccggctggtcgacttcgcccgggccaacggccagaccgtccgcggc
cacacgctggtctggcacagccagaacccggactggctgaccgaggacgcattcaccccc
gcccagctgcgcgcgctgctgcgcaagcacgtcatcgatcaggtgacccacttcaagggc
cggatctggcactgggacgtcgccaacgagatcttcaacgacgacggcacctggcgcgac
accatctggctgcgcaacctcgggaagggctacgtcgccgacgcgttccgctgggcccgc
caggccgacccgcaggccaagctcttcctgaacgactacaacaacgagggtgtcaacgcc
aagagcgacgcgtactaccggctggtccgcgagctcaaggcgcagcgggtgcccgtcgac
ggctacggcatccagggccacctcgccgtccagtacggcgtacccggcgacacgctggcc
aacctgcgccggttcgaggcgctcggcctgcagaccgccttcaccgaggtcgacgtacgc
atgcccctgcccgccgacccgatcaaggtccaggcgcaggctcagggcttcacggcgctg
ctccaggcctgcctgctggcccggcgctgcgtgtcgtacacgctgtggggcttcaccgac
cgctactcgtgggttccggacgtcttcgacggtgagggttcggcgacaccgctggacgcc
gatctggtccccaagcccgcgtggttcgcgatgcgcgacaccctgacactcgccgggcgc
tga

DBGET integrated database retrieval system