KEGG   Actinoplanes friuliensis: AFR_18170Help
Entry
AFR_18170         CDS       T02892                                 

Definition
L-amino-acid oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
afs  Actinoplanes friuliensis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFR_18170
   00330 Arginine and proline metabolism
    AFR_18170
   00340 Histidine metabolism
    AFR_18170
   00350 Tyrosine metabolism
    AFR_18170
   00360 Phenylalanine metabolism
    AFR_18170
   00380 Tryptophan metabolism
    AFR_18170
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     AFR_18170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3940222..3941805)
Genome map
AA seq 527 aa AA seqDB search
MRESVSRRRFLQSVGVSGGAGALFATMGALGLAPAAAAPAPPFDPPRKSDFSLTGRSAKR
VVILGGGIAGLAAAYELGKAGYDCTILEARGVAGGRNLTVRGGTTETDLDGQTQRASFSP
GIYLNAGPARIAQWMVTLDYCRELGVPIEPFVNANADALIYNEANGKPVRYRTAKADVYG
YVSELLAKATDQGALDGQLTATDKERVLSFLQSFGAIGGRTAGWEYQGTNRRGYASYPGA
GNDAGTPLDGPAALADVFASNVGRYFSFEFGYDQAMMMFQPVGGMDRIPYALSRAIGAGR
IRLGAEITAVTDKPDGVEVTYRREGRTRTIEADFCVAALPPHLMARIPHNLGTAVQSALG
SFPVTASGKIGLEYAGRWWENDLRIYGGITETDLDVSHIWYPSTGFHADRGLIVGYYNTG
ANARAYGSLTPEQRLLRAVEQGVKIHGEKYRSELTHSFSIAWHRTRYLEGAWTSPPWGSA
GYNLLLQPAGHVHFAGDWLSHEVAWQHGAFVSARAAVTALHQRVLAH
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaaagtgtcagccgtcggcggttcctgcagtccgtcggtgtcagcgggggtgcc
ggcgccctcttcgccaccatgggagcactcgggctggcaccggccgccgcggcgcccgcg
ccaccgttcgacccgccgcggaagtccgacttcagtctcaccgggcgcagcgccaagcgg
gtggtgatcctcggtggcggcatcgccgggctcgccgcggcgtacgagctgggcaaggcc
gggtacgactgcacgatcctggaggcccgcggggtggccggcgggcgcaacctcaccgtc
cggggcggcacgaccgagaccgatctggacgggcagacgcagcgggcgtcgttctccccc
ggcatctacctcaacgccggcccggcgcgcatcgcccagtggatggtcaccctcgactac
tgccgcgagctcggtgtgccgatcgaacccttcgtgaacgccaacgccgacgcgctgatc
tacaacgaggcgaacggcaagcccgtccgctaccgcacggcaaaggcggacgtctacgga
tacgtctcggaactgctggccaaggccaccgaccagggcgccctcgacggtcagctgacc
gccaccgacaaggaacgggtgctgtcgttcctgcagagcttcggcgccatcgggggccgc
accgcgggctgggagtaccagggcaccaaccgccgcggctacgcgagctaccccggcgcc
ggcaacgacgccgggacgcccctggacggtccggcggcgctcgcggacgtcttcgccagc
aacgtcggacgctacttcagcttcgagttcggttacgaccaggccatgatgatgttccag
cccgtcggtggcatggaccgcatcccgtacgccctgagccgcgcgatcggcgcgggcagg
atccggctcggtgccgagatcaccgccgtgaccgacaagccggacggtgtcgaggtcacc
taccgccgcgagggccggacccgcacgatcgaggccgacttctgtgtcgccgcgctgcca
ccgcacctgatggcccggatcccgcacaacctcggcaccgcggtgcagtcggcgctcggc
tccttccccgtcaccgcctccggcaagatcggtctggagtacgccggccgctggtgggag
aacgacctgcggatctacggcggcatcaccgagaccgacctggacgtctcgcacatctgg
tacccgtcgacgggcttccacgccgaccgaggcctgatcgtgggctactacaacaccggt
gcgaacgcccgcgcgtacggctcgctgacccccgagcagcgtctgctgcgggcggtcgag
cagggcgtgaagatccacggcgagaagtaccggtcggagctgacccactcgttctcgatc
gcctggcaccgtacgcgctacctcgagggcgcgtggacctcaccaccgtggggttcggcg
ggttacaacctgctgctgcagcccgccgggcacgtgcacttcgccggcgactggctcagt
cacgaggtggcgtggcagcacggggcgttcgtctcggcccgtgccgccgtcaccgctctg
caccagcgggtgctggcgcactga

DBGET integrated database retrieval system