KEGG   Actinoplanes friuliensis: AFR_19380Help
Entry
AFR_19380         CDS       T02892                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
afs  Actinoplanes friuliensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4235252..4237036)
Genome map
AA seq 594 aa AA seqDB search
MRTRQVVAAATTTVLAAALLAVGVVRQGDQAEASTASPGPKDVIVHLFEWPWASVANECT
TTLGPKGFGGVQVSPPQEHVVLPGSGYPWWQDYQPVSYQLKTRRGDRAAFASMVQTCHTA
GVKIYVDAVVNHMAGGTSTGTGSGGSAYSHYAYPAVPYGTDDFHHCGRNGNDDIANYGDR
WEVQNCELVDLSDLKTESSYVRGKLTAYLNDLVGLGVDGFRVDAAKHMPAADMAAFIDPV
NGDPYVFSEVIEGGSGEPTPEEYQGIGDVTEFRYGDVVGGAFQNGSLSNLNNLASSMRLA
SGDAVAFVDNHDTQRNGKAKLTYKNGSSYALAEAFMIAWPYGVPQVMSSFTFSNNDAGPP
AASNGTTNAVTCGSGWECEHRWRTTANMVGLRNAAAGAGVTNWWTNGSNQIAFGRGSTGY
AAFNRSGSALTRTFQTSLPAGTYCDVMAGDFSGGSCTGPAYAVNSSGQVTATVAANSALA
LHVNARGSGSTTPPPASGCSTTFSANVTTTWGQNVFVTGNTAALGNWNPAAAVPLSSATY
PVWTATVSLPGNTAVQYKYLKKEGSTVVWESDPNRTRTTGASSPCTATWNDTWR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccgtcaggttgtcgccgccgcgacgaccaccgtcctcgccgcggcgctgctg
gccgtcggcgtcgtccgccagggcgaccaggccgaggcgtccaccgcctcgccgggcccc
aaggacgtcatcgtccacctcttcgagtggccctgggcgtcggtcgcgaacgaatgcacg
accacgctgggccccaaggggttcggcggcgtgcaggtctccccgccccaggaacacgtg
gtgctgcccggcagcgggtacccctggtggcaggactatcagccggtcagttaccagctc
aagacacgtcggggtgaccgggcggccttcgcgagcatggtccagacgtgccacaccgcg
ggcgtgaagatctacgtggacgcggtggtcaaccacatggccggcggtacgtccacgggc
accggcagcggcgggtcggcctacagccactacgcctatccggccgtgccctacggcacc
gacgacttccaccactgcggacgcaacggcaacgacgacatcgcgaactacggcgaccgg
tgggaggtccagaactgcgagctcgtcgacctgtcggacctcaagaccgagtcctcgtac
gtgcggggcaagctcaccgcgtacctgaacgatctggtcggtctgggtgtcgacggcttc
cgggtggacgcggccaagcacatgccggccgcggacatggcggccttcatcgacccggtg
aacggtgacccgtacgtcttctccgaggtcatcgagggcggctccggcgagccgacaccc
gaggagtaccagggcatcggcgacgtcacggagttccgctacggcgacgtcgtgggcggg
gcgttccagaacggcagcctgtccaacctcaacaacctcgcgagctcgatgcgcctcgcg
agcggtgacgcggtggccttcgtggacaaccacgacacccagcgcaacggcaaggccaaa
ctcacctacaagaacggttcctcgtacgccctcgcggaggcgttcatgatcgcctggccg
tacggtgtgccgcaggtgatgtcgagcttcaccttcagcaacaacgacgccggtccgccc
gccgcgagcaacggcacgaccaacgccgtgacgtgcggcagcggctgggagtgcgagcac
cgctggcgcacgaccgcgaacatggtcgggctgcgcaacgccgccgccggcgcgggtgtc
accaactggtggacgaacggttccaaccagatcgccttcggccggggcagcaccgggtac
gccgcgttcaaccggtccggctcggcgctgacccgcacgttccagacgtcgctgcccgcc
ggcacctactgcgacgtcatggccggcgacttctcgggcggatcgtgcacgggtcccgcg
tacgcggtgaacagcagcggtcaggtgaccgcgaccgtcgcggcgaactcggccctggcc
ctgcacgtgaacgcccgcggctccggttcgaccacgccgccgcccgcctcgggctgctcc
accaccttctcggcgaacgtcaccaccacgtggggccagaacgtcttcgtcaccggaaac
acggcggcgctcggcaattggaacccggccgccgcggtgccgctctcgtcggcgacctac
ccggtgtggacggcgacggtgtcactgcccgggaacaccgcggtgcagtacaagtacctg
aagaaggaaggctcgaccgtcgtctgggagagcgacccgaaccgcaccaggacgaccggt
gcctcgtcgccgtgcacggcgacctggaacgacacctggcgctga

DBGET integrated database retrieval system