KEGG   Actinoplanes friuliensis: AFR_19380Help
Entry
AFR_19380         CDS       T02892                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00500  Starch and sucrose metabolism
afs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFR_19380
Enzymes [BR:afs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AFR_19380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AGZ42148
UniProt: U5VYV8
Position
complement(4235252..4237036)
Genome map
AA seq 594 aa AA seqDB search
MRTRQVVAAATTTVLAAALLAVGVVRQGDQAEASTASPGPKDVIVHLFEWPWASVANECT
TTLGPKGFGGVQVSPPQEHVVLPGSGYPWWQDYQPVSYQLKTRRGDRAAFASMVQTCHTA
GVKIYVDAVVNHMAGGTSTGTGSGGSAYSHYAYPAVPYGTDDFHHCGRNGNDDIANYGDR
WEVQNCELVDLSDLKTESSYVRGKLTAYLNDLVGLGVDGFRVDAAKHMPAADMAAFIDPV
NGDPYVFSEVIEGGSGEPTPEEYQGIGDVTEFRYGDVVGGAFQNGSLSNLNNLASSMRLA
SGDAVAFVDNHDTQRNGKAKLTYKNGSSYALAEAFMIAWPYGVPQVMSSFTFSNNDAGPP
AASNGTTNAVTCGSGWECEHRWRTTANMVGLRNAAAGAGVTNWWTNGSNQIAFGRGSTGY
AAFNRSGSALTRTFQTSLPAGTYCDVMAGDFSGGSCTGPAYAVNSSGQVTATVAANSALA
LHVNARGSGSTTPPPASGCSTTFSANVTTTWGQNVFVTGNTAALGNWNPAAAVPLSSATY
PVWTATVSLPGNTAVQYKYLKKEGSTVVWESDPNRTRTTGASSPCTATWNDTWR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacccgtcaggttgtcgccgccgcgacgaccaccgtcctcgccgcggcgctgctg
gccgtcggcgtcgtccgccagggcgaccaggccgaggcgtccaccgcctcgccgggcccc
aaggacgtcatcgtccacctcttcgagtggccctgggcgtcggtcgcgaacgaatgcacg
accacgctgggccccaaggggttcggcggcgtgcaggtctccccgccccaggaacacgtg
gtgctgcccggcagcgggtacccctggtggcaggactatcagccggtcagttaccagctc
aagacacgtcggggtgaccgggcggccttcgcgagcatggtccagacgtgccacaccgcg
ggcgtgaagatctacgtggacgcggtggtcaaccacatggccggcggtacgtccacgggc
accggcagcggcgggtcggcctacagccactacgcctatccggccgtgccctacggcacc
gacgacttccaccactgcggacgcaacggcaacgacgacatcgcgaactacggcgaccgg
tgggaggtccagaactgcgagctcgtcgacctgtcggacctcaagaccgagtcctcgtac
gtgcggggcaagctcaccgcgtacctgaacgatctggtcggtctgggtgtcgacggcttc
cgggtggacgcggccaagcacatgccggccgcggacatggcggccttcatcgacccggtg
aacggtgacccgtacgtcttctccgaggtcatcgagggcggctccggcgagccgacaccc
gaggagtaccagggcatcggcgacgtcacggagttccgctacggcgacgtcgtgggcggg
gcgttccagaacggcagcctgtccaacctcaacaacctcgcgagctcgatgcgcctcgcg
agcggtgacgcggtggccttcgtggacaaccacgacacccagcgcaacggcaaggccaaa
ctcacctacaagaacggttcctcgtacgccctcgcggaggcgttcatgatcgcctggccg
tacggtgtgccgcaggtgatgtcgagcttcaccttcagcaacaacgacgccggtccgccc
gccgcgagcaacggcacgaccaacgccgtgacgtgcggcagcggctgggagtgcgagcac
cgctggcgcacgaccgcgaacatggtcgggctgcgcaacgccgccgccggcgcgggtgtc
accaactggtggacgaacggttccaaccagatcgccttcggccggggcagcaccgggtac
gccgcgttcaaccggtccggctcggcgctgacccgcacgttccagacgtcgctgcccgcc
ggcacctactgcgacgtcatggccggcgacttctcgggcggatcgtgcacgggtcccgcg
tacgcggtgaacagcagcggtcaggtgaccgcgaccgtcgcggcgaactcggccctggcc
ctgcacgtgaacgcccgcggctccggttcgaccacgccgccgcccgcctcgggctgctcc
accaccttctcggcgaacgtcaccaccacgtggggccagaacgtcttcgtcaccggaaac
acggcggcgctcggcaattggaacccggccgccgcggtgccgctctcgtcggcgacctac
ccggtgtggacggcgacggtgtcactgcccgggaacaccgcggtgcagtacaagtacctg
aagaaggaaggctcgaccgtcgtctgggagagcgacccgaaccgcaccaggacgaccggt
gcctcgtcgccgtgcacggcgacctggaacgacacctggcgctga

DBGET integrated database retrieval system