KEGG   Actinoplanes friuliensis: AFR_27110Help
Entry
AFR_27110         CDS       T02892                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afs  Actinoplanes friuliensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5881847..5884009
Genome map
AA seq 720 aa AA seqDB search
MIGQTTPPTPAVTGDQRALNAVVSGDTHDPHGVLGTHPSGDKTVIRTMRKGAKDVFVVVD
GEKTPMAQVHPDGIFAVELPGTVLDYRLDVDGTVCDDPYRHLPSLGELDLHLIGEGRHEK
LWKVLGAQPRDGGVAFAVWAPSARGVQVIGDVVGWGPFDGWPMRSLGSSGVWELYVPGAS
SGTKYKFKILGRDGVWREKADPLAQHTEIPPRTASVVFASSYEWQDADWMAERAKKQWHQ
EPMSAYEVHLGSWRPGLSYVELAEQLVDYVVETGFTHVELMPVMEHPFGGSWGYQVTGYF
APTSRFGSPDEFRYLVDKLHQAGIGVILDWVPAHFPKDEWALARFDGTPLYEHGDWRRGE
HPDWGTYVFDFGRREVRNFLVANANYWCEEFHADGLRVDAVASMLYLDYSRKEGEWTPNQ
YGGRENLDAISFLQEMNATVYRNNPGVVTIAEESTAWPGVTRPTHLGGLGFGFKWNMGWM
NDTLSYMEKEPIYRQWHHHQMTFATVYAWSENYILPISHDEVVHGKGSLTGKMPGDDWQK
LANTRALFGFMWAFTGKQLIFMGTEMGDRQEWSEERGLDWDLLADDSRGGGIHKLIQDLN
RVYKESPALWTQDTTASGFRWITSEDSQHNTFSFLRFAPNGDTLACIVNFAAVPHENYRI
GLPRPGVWREVVNTDSSLYGGSGVGNLGEVHAEEMPWHGLNASASLRVPPLGAVWLKLDA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcagaccaccccgcccacgcccgctgtgaccggtgaccagcgtgccttgaac
gccgtcgtctccggcgacacccacgacccgcacggtgtgctgggcacccacccgtccggt
gacaagacggtcatccgcaccatgcgcaagggtgccaaggacgtttttgtcgtcgtcgac
ggcgagaagaccccgatggcccaggtccaccccgacggcatcttcgccgtcgagctcccg
ggtacggtgctcgactaccggctcgacgtcgacgggacggtctgcgacgacccgtaccgg
catctgcccagcctgggcgagctggacctgcacctgatcggtgagggccggcacgagaag
ctgtggaaggtcctgggtgcgcagccgcgggacggcggcgtggccttcgccgtgtgggcg
ccgagcgcccgcggcgtgcaggtcatcggcgacgtggtcggctggggcccgttcgacggc
tggccgatgcgctcgctcggcagcagcggcgtctgggagctctacgtccccggcgcgtcg
tccggcaccaagtacaagttcaagatcctcggtcgtgacggtgtctggcgcgagaaggcc
gacccgctggcccagcacaccgagatccccccgcgtacggcgtcagtcgtttttgcctcg
tcctacgaatggcaggacgccgactggatggccgaacgcgcgaagaagcagtggcaccag
gaaccgatgagcgcctacgaggtgcacctcggctcgtggcggcccggcctgtcctacgtc
gagctggctgagcagctggtcgactacgtggtggagaccggcttcacgcacgtcgagctg
atgcccgtcatggagcacccgttcggtggctcctggggttaccaggtcaccggctacttc
gcgccgacgtcccgcttcggttcgccggacgagttccgctacctggtcgacaagctgcac
caggccggcatcggcgtcatcctcgactgggtgcccgcccacttccccaaggacgagtgg
gccctggcccgcttcgacggcaccccgctctacgagcacggtgactggcgccgcggcgag
caccccgactggggcacgtacgtcttcgacttcggccggcgcgaggtccgcaacttcctg
gtggccaacgccaactactggtgcgaggagttccacgccgacggcctgcgtgtcgacgcc
gtcgcctcgatgctctacctggactactcgcgcaaggaaggcgagtggacccccaaccag
tacggcggccgggagaacctcgacgcgatcagcttcctccaggagatgaacgcgaccgtc
taccgcaacaaccccggcgtggtcaccatcgccgaggagtcgacggcgtggccgggcgtc
acccgcccgacacacctcggtggtctcggcttcggcttcaaatggaacatgggctggatg
aacgacaccctctcctacatggagaaggagcccatctaccgccagtggcaccaccaccag
atgaccttcgccaccgtgtacgcgtggagcgagaactacatcctcccgatcagccacgac
gaggtcgtccacggcaagggttccctcaccggcaagatgcccggcgacgactggcagaag
ctcgccaacacccgcgccctgttcggcttcatgtgggccttcaccggcaagcagctcatc
ttcatgggtaccgagatgggcgaccgtcaggaatggagtgaggaacgcggcctcgactgg
gacctcctcgccgacgacagccgcggtggtggcatccacaagctgatccaggacctgaac
cgcgtgtacaaggaatcccccgcgctgtggacccaggacacgaccgcgagcggcttccgc
tggatcacgagcgaggactcccagcacaacacgttctcgttcctccgcttcgccccgaac
ggcgacacgctggcctgcatcgtcaacttcgcggcggtcccgcacgagaactaccgcatc
ggcctcccccgccccggcgtctggcgcgaggtcgtcaacaccgacagctccctctacggc
ggctcgggtgtcggcaacctcggtgaggtccacgccgaagaaatgccctggcacggcctg
aacgcctcggcgtcgctccgggtgcccccgctgggcgcggtctggctcaagctcgacgcc
tga

DBGET integrated database retrieval system