KEGG   Actinoplanes friuliensis: AFR_27785Help
Entry
AFR_27785         CDS       T02892                                 

Definition
putative aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
afs  Actinoplanes friuliensis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:afs00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:afs00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:afs00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:afs00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:afs00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6042712..6043998
Genome map
AA seq 428 aa AA seqDB search
MTSSEELQKRRHSAVARGVTSVVPSYVDRASGGSITDVDGHEWIDFGSGIAVTSVGNAAP
RVVAAVREQVERFTHTCFMVAPYESYIAVCEQLATLTPGSFDKRAALFNSGAEAVENAVK
IARHATGRQAVVVFDHAYHGRTNLTMALTAKSMPYKHRFGPFAPEVYRAPMSYPLRDGGL
TGPEAAARAIDVIEKQVGAANVAAVLIEPIQGEGGFVVPAAGFLPALAAWVREAGAVFIA
DEVQTGFCRTGSWFACEDEGVEPDLVTTAKGMAGGLPLAGVVGRAELMDAVHPGGLGGTY
GGNPIACAAALAAIETMRELDLNAAARHLEELFRPRLTALAADDPGIGEVRGRGAMLAIE
LVKPGSIEPDPLRTAAVARACHSAGLLVLTCGTYSNVLRFLPPLVISDEQVARGLGILTE
SLLAHRPG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctccgaggaactgcagaagcgcaggcactccgccgtcgcccgcggagtcacg
tccgtggtgccgtcctacgtggaccgtgcgtccggcggcagcatcaccgacgtcgacggc
cacgagtggatcgacttcggctcgggcatcgcggtcaccagcgtcggcaacgcggcgccc
cgggtggtggccgccgtgcgggagcaggtcgagcggttcacgcacacctgcttcatggtc
gcgccgtacgagtcgtacatcgcggtgtgcgagcagctggcgacgctgacaccggggtcg
ttcgacaagcgtgcggccctgttcaactccggtgccgaggcggtggagaacgccgtcaag
atcgcgcggcacgcgacgggacggcaggccgtggtggtgttcgaccacgcgtaccacggg
cggaccaacctgacgatggcgctgacggcgaagtccatgccgtacaagcaccggttcggc
ccgttcgcaccggaggtctaccgggcaccgatgtcgtacccgctgcgcgacggcgggctg
accggcccggaagccgcggcccgggcgatcgacgtcatcgagaagcaggtcggtgccgcg
aacgtcgcggcggtgctgatcgagccgatccagggtgagggcggttttgtcgtcccggcc
gccgggttcctgccggccctggccgcctgggtgcgcgaggccggcgcggtgttcatcgcc
gacgaggtacagaccggtttctgccgcacgggctcgtggttcgcctgcgaggacgagggt
gtggagcccgacctggtgacgacggccaagggcatggccggtgggctgccgctggccggt
gtggtcggccgggccgagctgatggacgcggtccacccgggcgggctgggcggcacctac
ggcggcaacccgatcgcctgcgcagcggcgctggccgccatcgagaccatgcgtgagctg
gacctgaacgccgcggcccggcacctcgaggagctgttccggccccggctcaccgcgctc
gcggcggacgacccgggaatcggcgaggtgcgcgggcgcggcgcgatgctggcgatcgag
ctggtcaagccgggcagcatcgaaccggacccgctgcggaccgccgcggtggcccgggcc
tgccacagcgcggggctgctggtgctgacctgcggcacctacagcaacgtgctgcgattc
ctgccgccgctggtgatcagcgacgagcaggtggcccggggcctcggcatcctcaccgag
tcactgctcgcgcatcgcccagggtga

DBGET integrated database retrieval system