KEGG   Actinoplanes friuliensis: AFR_34985Help
Entry
AFR_34985         CDS       T02892                                 

Definition
(GenBank) putative PfkB-family carbohydrate kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
afs  Actinoplanes friuliensis
Pathway
afs00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFR_34985
Enzymes [BR:afs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AFR_34985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB NAD_binding_10 Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AGZ45253
UniProt: U5W7S0
Position
complement(7641480..7642370)
Genome map
AA seq 296 aa AA seqDB search
MKPPVATVVGQLARDLVLSVGAVPDTGAAADATDRREQLGGKGANQAVGLAQLGVVPRLV
AVAGEDIIGDVLLDQARRDGIDVTAVVRRPGALTGLIVELLDSDGQWRYVQHLSEEVLLT
VRDVERARDVISGADAVLVQLQQPAAAALAAARIGHDAGRLVVLDGVPEEHRDELLAAAD
VVRADDQEARLLLDGPVTPAAARRLLDDGPRLLALGVEDGNLFVWKDGHVRLPLTGGKPV
DTTGGGDAFTAALTASLLRGEDYSLAARWAVAASGATVTHVSGRPSLAGLQVSADG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctccggtagcgaccgtagttgggcaactcgcccgtgacctcgtcctgtccgtc
ggtgccgtcccggacaccggtgccgcggcggatgcgacggaccggcgcgagcaactgggc
ggcaagggcgccaatcaggcggttggactggcccagctgggggtagtcccgaggctggtg
gcggtggccggcgaggacatcatcggcgacgtgctgctcgaccaggccaggcgcgacggc
atcgacgtcaccgcggtggtacgccgccccggcgcgctcaccggcctgatcgtcgaactg
ctcgacagcgacggccagtggcgttatgtccagcatctcagcgaggaggtcctgctcacc
gtgcgcgacgtggaacgggcgcgagacgtgatcagcggggctgacgccgtactcgtgcag
ttgcagcaacccgccgcggccgcgctggccgcagcacggatcgggcacgacgcgggccgg
ctggtggtgctcgacggcgtgccggaggagcaccgggacgagctgctcgcggcggccgac
gtggtgcgcgcggacgatcaggaggcccggttgctgctggacggacctgtcacgcccgcg
gcggcacggcgcctgctcgacgacggcccgcggctgctcgcgctgggtgtcgaggacggc
aacctcttcgtctggaaggacggtcacgtgcgtctgcctctcaccggcggcaagccggtc
gacaccaccggcgggggtgacgccttcaccgccgcgctgacggcctccttgctgcgcggc
gaggactattcactcgcggcccgctgggcggtcgcggcctcgggcgccacggtcacgcac
gtcagcggtcgtccttctctcgccggtctgcaggtctccgccgatgggtga

DBGET integrated database retrieval system