KEGG   Actinoplanes friuliensis: AFR_34985Help
Entry
AFR_34985         CDS       T02892                                 

Definition
putative PfkB-family carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
afs  Actinoplanes friuliensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFR_34985
Enzymes [BR:afs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AFR_34985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7641480..7642370)
Genome map
AA seq 296 aa AA seqDB search
MKPPVATVVGQLARDLVLSVGAVPDTGAAADATDRREQLGGKGANQAVGLAQLGVVPRLV
AVAGEDIIGDVLLDQARRDGIDVTAVVRRPGALTGLIVELLDSDGQWRYVQHLSEEVLLT
VRDVERARDVISGADAVLVQLQQPAAAALAAARIGHDAGRLVVLDGVPEEHRDELLAAAD
VVRADDQEARLLLDGPVTPAAARRLLDDGPRLLALGVEDGNLFVWKDGHVRLPLTGGKPV
DTTGGGDAFTAALTASLLRGEDYSLAARWAVAASGATVTHVSGRPSLAGLQVSADG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctccggtagcgaccgtagttgggcaactcgcccgtgacctcgtcctgtccgtc
ggtgccgtcccggacaccggtgccgcggcggatgcgacggaccggcgcgagcaactgggc
ggcaagggcgccaatcaggcggttggactggcccagctgggggtagtcccgaggctggtg
gcggtggccggcgaggacatcatcggcgacgtgctgctcgaccaggccaggcgcgacggc
atcgacgtcaccgcggtggtacgccgccccggcgcgctcaccggcctgatcgtcgaactg
ctcgacagcgacggccagtggcgttatgtccagcatctcagcgaggaggtcctgctcacc
gtgcgcgacgtggaacgggcgcgagacgtgatcagcggggctgacgccgtactcgtgcag
ttgcagcaacccgccgcggccgcgctggccgcagcacggatcgggcacgacgcgggccgg
ctggtggtgctcgacggcgtgccggaggagcaccgggacgagctgctcgcggcggccgac
gtggtgcgcgcggacgatcaggaggcccggttgctgctggacggacctgtcacgcccgcg
gcggcacggcgcctgctcgacgacggcccgcggctgctcgcgctgggtgtcgaggacggc
aacctcttcgtctggaaggacggtcacgtgcgtctgcctctcaccggcggcaagccggtc
gacaccaccggcgggggtgacgccttcaccgccgcgctgacggcctccttgctgcgcggc
gaggactattcactcgcggcccgctgggcggtcgcggcctcgggcgccacggtcacgcac
gtcagcggtcgtccttctctcgccggtctgcaggtctccgccgatgggtga

DBGET integrated database retrieval system