KEGG   Actinoplanes friuliensis: AFR_35170Help
Entry
AFR_35170         CDS       T02892                                 

Definition
putative protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
afs  Actinoplanes friuliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFR_35170
Enzymes [BR:afs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AFR_35170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7671629..7673023)
Genome map
AA seq 464 aa AA seqDB search
MRKRVAVVGGGIAGLAAAVRIRDRAPADTEIIVYEQSGRLGGKLRTGELAGTVVERGAES
FLIGGPDGGESAAVRFVRRVGLGDSLVHPAAVPAALAIAGRLEPVPKGTLVGVPGDLTSL
GAVARPAADADRDEGRPLLAPGADIAVGALVRARYGDEVADRLVDPMLGGVYAGRADRLS
LATTMPALARTARTEHTLAGAVRAAQAASVRVPGRPIFGAVAGGMGRLVAAAAGPRRPAQ
PRPAVRELARTSHGWRLLIGPVWEPQTDDVDAVVLAVPARPASRLISGLDLSAAAEIEEL
DYASVALAAFALPPGTPLPDLSGFLVPPTEGTLVKAATFFTHKWSHLHREGGPVIIRASL
GRVGEEERLQHDDTVLAATAHAELGKLLGDALPPPVASWVQRWGGGLPQYAPGHLDRVAL
ARAALATSPGLSLAGAAFDGVGIPACVASGEKAADDVLKYLEER
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaagcgtgttgcggtcgtgggtggcggaatcgccgggctcgctgccgccgtacgg
atccgggaccgcgcccccgccgacaccgagatcatcgtgtacgagcagtcgggccgtctc
ggcggcaaactgcgcaccggtgagctggccggcaccgtcgtcgagcggggcgccgagtcg
ttcctgatcggtggcccggacggtggtgagtccgcagctgtgcgcttcgtccgccgggtc
ggcctcggcgactccctcgtgcacccggccgctgtgccggcggcgctggccatcgccggg
cgcctcgagccggtgccgaagggcacgctggtgggcgtacccggtgatctgacgtccttg
ggggcagtggcgcgaccggcggcggacgccgaccgcgacgagggccgcccgctgctcgcg
cccggcgccgacatcgccgtgggcgcgctggtccgggcccggtacggcgacgaggtggcc
gaccggctcgtcgatccgatgctcggcggtgtctacgcgggccgcgccgaccggctgtcc
ctggcgaccaccatgcccgcgctggcccgcaccgcccgcaccgagcacaccctggccggc
gctgtccgcgctgctcaggccgcgtccgtgcgggtgccggggcgaccgatcttcggcgcg
gtcgccggcgggatgggccgcctggtcgccgccgccgcggggccgcggcgcccggctcag
cctcggcctgccgtccgcgagctggcccggacctcgcacgggtggcggctgctgatcggc
ccggtgtgggagccgcagaccgacgacgtcgacgccgtggtgctcgccgtgcccgcgcgc
ccggcgtcccggctgatctccggcctcgacctgtccgcggccgccgagatcgaggagctc
gattacgccagcgtcgcgctggccgcgtttgcgctgcctccgggcacaccgctgcccgac
ctgtcgggatttctggtgccgccgaccgagggcacgctggtcaaggcggcgacgttcttc
acgcacaagtggtcccacctgcaccgcgagggcgggccggtgatcatccgggcgtcgctc
gggcgcgtcggcgaggaggagcggttgcagcacgacgacaccgtgctcgccgcgaccgct
cacgccgagctgggcaaactgctcggtgacgcgttgccgccaccggtcgcgtcctgggtg
cagcgctggggcggtgggctcccgcagtacgcacccggtcacctcgaccgggtcgcgctg
gcccgggccgcactcgccaccagccccggcctctccctggccggcgccgccttcgacggc
gtcggcatcccagcctgtgtagccagcggcgagaaggccgccgacgacgtcttgaaatac
ttggaggagcgatga

DBGET integrated database retrieval system