KEGG   Actinoplanes friuliensis: AFR_39565Help
Entry
AFR_39565         CDS       T02892                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
afs  Actinoplanes friuliensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AFR_39565 (deoA)
Enzymes [BR:afs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AFR_39565 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8625600..8626877)
Genome map
AA seq 425 aa AA seqDB search
MSEFAAVDVIRAKRDGHTLSDAQIDWVVDAYTKGVVADEQMSALAMAILLRGMTPAEIAR
WTAAMIASGERLDLSAVTRPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWRAGLSNDEFVRQLQDVGAVICAAGDGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGTGAFMKDVDMARELARTMVELGKAHQVRTVALLT
DMNTPLGLAIGNAVEVEESLEVLAGGGPADVVELTLALAREMLAAAGLDADPEKVLQSGA
AMDSWKAMIRAQGGDPDAPLPTARETEVLRATTAGVVESIDALEVGLAAWRLGAGRARKE
DPVSFGAGIMLKVRPGDTVAVGDPLLELRTDEGSRISAALAGADGAVRISQNAPAPTPLL
IDRIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtttgctgcggttgacgtcattcgggcgaagcgggacgggcacacgctgtcc
gacgcgcagatcgactgggtggtcgacgcgtacacgaagggtgtggtcgccgacgagcag
atgtccgcgctggccatggccatcctgctgcgcggcatgacgccggcggagattgcccgc
tggaccgccgcgatgatcgccagcggcgagcgtctggacctctccgcggtgacccgcccg
accgtcgacaagcactccaccggcggtgtcggcgacaagatcacgctgccgctcacgccg
ctggtcgcagcctgcggcgccgccgtcccgcagctctcgggccgcggcctgggccacacc
ggcggcaccctcgacaagctggagtcgatccccggctggcgggccgggctgagcaacgac
gagttcgtccggcagctccaggacgtcggtgcggtcatctgcgccgccggcgacggcctc
gcccccgccgaccgcaagctctacgccctgcgtgacgtcacgggcaccgtcgaggccatc
ccgctgatcgccagctcgatcatgagcaagaagatcgcggagggcaccggcgcgctcgtc
ctcgacgtcaaggtcggcacgggtgcgttcatgaaggacgtcgacatggcccgcgagctg
gcccgcacgatggtcgagctgggcaaggcgcaccaggtgcggacggtggcgctgctcacc
gacatgaacaccccgctcgggctcgcgatcggcaacgccgtggaggtcgaggagtccctg
gaggtgctggccggtggtggtcccgccgacgtggtcgagctgacgctggccctggcccgc
gagatgctcgccgcggccggcctcgacgccgaccccgagaaggttctgcagtccggcgcg
gccatggactcctggaaggccatgatccgggcccagggcggcgaccccgacgcgccgctg
cccaccgcccgcgagaccgaggtgctgcgcgcgacgaccgccggtgtggtcgagagcatc
gacgcgctcgaggtcgggctggccgcctggcggctcggtgccggacgggcccgcaaggag
gacccggtcagcttcggcgcgggcatcatgctgaaggtccggcccggcgacaccgtggcc
gtgggcgacccgctgctcgaactccgtaccgatgaggggtcgaggatctccgccgcgctg
gcgggggcggacggggccgtgcggatctcgcagaatgcgcccgcccctacgcctttgctg
atcgaccgcatagcctga

DBGET integrated database retrieval system