KEGG   Actinoplanes friuliensis: AFR_42300Help
Entry
AFR_42300         CDS       T02892                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
afs  Actinoplanes friuliensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFR_42300
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AFR_42300
Enzymes [BR:afs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AFR_42300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9219036..9220889
Genome map
AA seq 617 aa AA seqDB search
MSTRRKAALVTAALVGVGAGIVLAPSAFAANEQVNVYLTTTSDGGGRTVTRGLQQQTPIN
FAGSSGSANQTITVNENTTYQTFEGAGASFTDTAAWLINGSGALSAATRNEVMTKLFSPT
AGIGVSATRNVMGSSDLARSSYSYDGTCCDVNDFSLSRDVDVMALTKQAKSLNPNLLVMG
SPWSAPSWMKDNNSYDQGYLKAEYYKAYAQYFVKYIQGYEAQGVRINYVTEQNEPGCCPG
YPSMQWSVSGLQSFAKNDLLPALQAAGLSTKLLVHDWNYSDYDTWGAPLVNDAAIRNHPN
FGGVGWHGYGGDPSKATTVRNQYPSMNQYFTEHSGGTWVGNQQAEDMNNLIDYTRNWARS
WTKWSLAVDQNMGPHNGGCGTCTGLVTVHNGDGRSGQVDYTIEYYTMGHLTKFVKPGAVR
VDSTANSTVKNVAWKNTDGSKALIAYNTSGSAQTVKVNWGGQSFVYSLPTKTSATFTWGG
SQGGTTPPVQKTGSISGLGGKCLDVTDGSTTNGNLPQLWTCTAGPNQTWTVGSDNTIRGL
GKCLDVSGNSTANGAAVHLWDCIDTVASQKWTASNGTLVNTASGKCLDVKDSNTANGAKL
QIWTCTGAANQKWNVPA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacccgtagaaaagccgcccttgtcactgccgccctggtcggcgtcggtgccggc
atcgtgctcgccccgagtgcgtttgccgcgaacgagcaggtcaacgtctatctgaccacc
accagtgacgggggcggccgaaccgtcacccgtggcctgcagcagcagaccccgatcaac
ttcgcgggcagcagcggcagcgccaaccagacgatcaccgtgaacgagaacaccacgtac
cagacgttcgagggtgcgggcgcctcgttcactgacaccgcggcctggctcatcaacggc
agcggcgcgctgtcggcggccacgcgcaacgaagtcatgacgaagctgttcagtccgacc
gccggcatcggcgtcagcgcgacccgcaacgtcatgggttcgtcggatctcgcccggtcc
agctactcctacgacggcacgtgctgtgacgtcaacgacttctcgctgagccgggatgtc
gacgtgatggctctgaccaagcaggcgaagagcctcaatccgaacctgctcgtcatgggc
tcgccctggtcggcgccgtcctggatgaaggacaacaacagctacgaccaggggtacctc
aaagccgagtactacaaggcgtacgcgcagtacttcgtgaagtacatccaggggtacgag
gctcagggcgtacgcatcaattacgtcaccgagcagaacgagccgggttgctgtcccggt
tatccgtccatgcagtggagtgtttcgggcctgcagtcgttcgccaagaatgacctgctc
ccggctttgcaggcggccggtctcagcacgaagctgctggtgcacgactggaattacagc
gattacgacacctggggcgcgccgctcgtcaacgacgccgcgatccggaaccaccccaat
ttcggcggggtcggctggcacggttacggcggcgatccttccaaggccaccacggtacgc
aaccagtacccgtccatgaaccagtatttcaccgagcactccggtggcacctgggtcggc
aatcagcaggccgaggacatgaacaacctcatcgactacacgcggaactgggcccggtcg
tggaccaagtggagtcttgccgtcgaccagaacatgggtccgcacaacggcggctgcggc
acctgcaccggcctggtcaccgtgcacaacggggacgggcgcagcggacaggtcgactac
accatcgagtactacacgatggggcacctgacgaagttcgtgaagccgggtgcggtgcgg
gtcgattccaccgccaattcgaccgtgaagaacgtcgcgtggaagaacaccgacgggtcg
aaggcgctgatcgcgtacaacaccagtggcagtgcgcagaccgtgaaggtgaactggggc
gggcagtcctttgtgtacagcctgccgacgaaaacttcggccacgttcacctggggtggc
tcgcagggtggcactactccgcccgtacagaagacggggtcgatctcgggtctgggcgga
aagtgcctggacgtgaccgacggctcgaccaccaacggcaatctgccgcagctctggacc
tgcacggccggcccgaatcagacctggaccgtcggcagtgacaacaccattcggggcctc
gggaagtgcctcgacgtgtcgggcaattcgaccgcgaacggtgcggctgtgcacctctgg
gattgcatcgacaccgtcgccagccagaagtggaccgcgagcaacgggaccctggtgaac
accgcgtccggcaagtgcctggacgtcaaggacagcaacaccgcgaacggcgccaagctg
cagatctggacctgcaccggtgccgccaaccagaagtggaacgtgcccgcatga

DBGET integrated database retrieval system