KEGG   Archaeoglobus fulgidus: AF0036Help
Entry
AF0036            CDS       T00011                                 

Gene name
pcm-1
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afu  Archaeoglobus fulgidus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
38739..39389
Genome map
AA seq 216 aa AA seqDB search
MDFDEKRRILAERLRDELNLSEKVYNAIKKVPRHLFVPERYRTMAYVDTPLPIGYGQTIS
APHMVAIMCELLDLREGERVLEIGTGCGYHAAVTAEIVGKRGLVVSVERIPELAEIAKRN
LSALGYENVVVIVGDGSLGYEPMAPYDKIYVTASAPDIPKPLLEQLKIGGKMVIPIGETT
QFLYVVERDNGVRKWSWGAVRFVPLYGKYGFRPLEE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgatgagaaaaggaggatccttgcagaaaggctgagggacgagctaaacctg
agcgaaaaagtttacaacgcaataaaaaaagttccgaggcatctcttcgttccagaacgc
tatagaactatggcttacgtcgatacacctttgccaataggctatgggcagacgataagc
gctccacacatggttgcgatcatgtgcgaactcctagatctgagagaaggggaaagagtt
ctcgaaattggaacgggttgcggttatcatgctgctgttacagctgagatcgttggaaaa
agaggactcgtagtttccgtggagagaattccggagctagcggagattgcgaagaggaat
ttatccgctcttggctacgagaacgtagtagttatcgttggcgatggcagcctgggctat
gaaccgatggcgccatacgataagatatacgtcacagcatcagcgccagacattccgaag
ccgcttttagaacagctcaaaattggtggaaaaatggttattccaatcggagaaactact
cagtttctctacgttgttgaaagggacaacggggttcgaaaatggagctggggggctgtt
aggttcgtcccgctttacggaaagtatggctttagacctcttgaggagtag

DBGET integrated database retrieval system