KEGG   Archaeoglobus fulgidus: AF0051Help
Entry
AF0051            CDS       T00011                                 

Gene name
dapE-1
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afu  Archaeoglobus fulgidus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:afu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(58049..59158)
Genome map
AA seq 369 aa AA seqDB search
MDPLEITKDLIKIDTRNPPGVTTEAVEYLSQLFSSYEQRIYAKEEGKENLVVYISRGKPE
IMLTSHLDTVPAGDELLNPVIVDGKLYGRGSCDAKGCVAAICSASQIEPECGLKLAFTSD
EEVGGVNGLGYVFEREKADAVIIGEPTGSESIGVLQAAVLALDIEFKGNSGHTASHDAKE
GAIYRASEYIVEKVESFRGLEGDFGSYREIFSKLGMDFAVKSWHAVFNPSMIRGGVKRNV
VAPKCTVYADVRFAPWISVEEVRRELYAENMEFRVEGFLQPYGVGCDAVKLEDDLRLLKI
MSEAIREEGLRPKAVFSLGVGDTRHVRKHGVPAFYLGPGGGNLHGEDEFVYVEELYRTAK
IYKNIVRRF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacccccttgagataaccaaagacctcataaaaatagacacccgcaaccctcccgga
gtgactactgaggctgtcgagtatctttcacagcttttctcgtcctacgagcaaaggatt
tacgcgaaggaggagggtaaggagaatctcgttgtttacatcagcaggggcaaacccgaa
atcatgctcacctcccacctcgataccgttcctgctggagacgagcttctgaaccccgtc
attgttgacggaaagctctacgggagggggagttgtgatgcgaagggctgtgttgcggca
atttgctcagcctcgcagatagagcctgagtgcgggctgaagctggccttcacctcagat
gaagaggttggaggggttaatgggctcggatatgtttttgaaagggaaaaggctgatgca
gtcataataggggagccgacggggagtgagagcatcggagttttgcaagctgccgttttg
gcgttggatatagagttcaagggaaattcggggcacacagcctctcacgacgctaaggag
ggggcgatatacagagcctccgagtacatcgttgagaaagttgaatccttcagagggctt
gagggggattttgggagctatagggaaattttcagcaagctcggcatggattttgctgtt
aaaagctggcatgcggtcttcaatccttctatgattaggggaggggttaagaggaatgtt
gttgctccgaagtgcacggtttacgccgacgtaagattcgccccgtggataagcgttgaa
gaagtgagaagagagctttacgccgagaacatggagttcagggtggagggctttctgcag
ccctacggtgttggctgcgatgctgttaagcttgaggatgacttaaggctgctgaaaatt
atgagcgaggcaataagggaagagggattgaggccgaaggctgtgttttccttgggtgtt
ggagatacgaggcacgtcagaaagcacggagttcccgcattctacttgggtccgggtggg
gggaatttgcacggtgaggacgagttcgtttacgtggaggagctttacagaacggcaaaa
atttacaaaaatattgtcagaaggttctga

DBGET integrated database retrieval system