KEGG   Archaeoglobus fulgidus DSM 4304: AF0116Help
Entry
AF0116            CDS       T00011                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AF0116 (hemD)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AF0116 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107215..107895
Genome map
AA seq 226 aa AA seqDB search
MKVLILRPAELLSETIRRFREEGFDAYGCPFIKLIYTDFDVPEHDFAIVTSQNAARVLRE
RGVRLKRVIAIGKKTAELIEAEEVLLPSKFDSETLYEEFAEMLRGKRVVAFRSNAGSEAV
KRLSEVADFREIQVYRIEKLQGEEQRREVEKVREGFYDAIVFSSSMIARSLLELCDEKCL
EALKNIFVVAIGPPTAKVLAEKGIRAEIPEEYTFDGVIELLKSKKM
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttctgattctccgtccggctgagctgctcagcgagacgattaggaggttccgc
gaggagggattcgacgcctacggatgccccttcataaagctaatctacacagatttcgat
gttccggagcacgacttcgcgatagttacgagccagaatgctgcgcgagttttgagggag
aggggtgtcaggctgaaaagagtaatagccatcggcaaaaaaaccgctgagctaatagag
gctgaggaagtgcttttgccctcaaaattcgactccgagaccctttacgaagaatttgct
gaaatgcttaggggaaaaagggtggtggccttcaggagcaatgctggcagtgaggcagta
aaaagactgtcggaagtggcagatttcagggaaatccaggtttacagaatcgaaaagctg
cagggagaggagcagagaagagaggttgagaaggttagagagggattttatgatgcaatt
gttttctcaagcagcatgatagcgagaagccttcttgagctgtgcgatgaaaaatgctta
gaggcccttaagaacatcttcgttgtagccatcggccctcccacggcaaaggttttggct
gaaaagggtataagggcggagataccggaagagtacacatttgatggggtgatagagctt
ttaaagtccaagaagatgtag

DBGET integrated database retrieval system