KEGG   Archaeoglobus fulgidus: AF0212Help
Entry
AF0212            CDS       T00011                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
afu  Archaeoglobus fulgidus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:afu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(188172..189386)
Genome map
AA seq 404 aa AA seqDB search
MEEILRLRRSVSIDDYIEKVKPIVEAVKREGDKAVIRFTRDLDGVELDSLRVTEDEFEKA
YDAVDDGLIDALEVAKENIYRFHYVTSVERDMKVEFEDCVMGKIYTPIEKVGAYIPGGRA
SYPSTALMIGVPAKIAGVEKLVACTPPNKDGKVNPLTLVALDIAEFDEVYKAGGAQAIAA
MAYGTETVEKVYKIVGPGNIYVTAAKLLVAKDVAIDMPAGPSEILVIADETANADFIACD
CLAQLEHDPMAVAVVLTTSRKVADEVEKKVKSEGDFSNFAVFVVEDLAEAFEISNEFAPE
HLTVAVKNPEEWLGKVRNAGSVFLGNFSPVAAGDYASGTNHVLPTAGYAKIYGGLSVESF
LKHFTFQMLSEESMRRIGGDVVKIAEAEGLRWHAESVRKRLEKI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaattctgaggctcagaaggagtgtcagcattgacgattacattgaaaaggta
aagccaatcgttgaggccgtcaaaagggagggagataaagctgtaatccgatttacgagg
gatttggacggagtcgagcttgacagcctgagagttacggaggatgagtttgagaaggct
tatgatgcggtggatgacggcctcattgacgctcttgaagtggcgaaggagaacatctac
aggttccactacgtcacatcagttgagagggatatgaaggttgagttcgaggactgcgtt
atggggaaaatctacacccccatagagaaggttggcgcttacattccaggcgggagagca
agctatccatcaacggccttaatgataggcgttccggcaaagattgcgggagttgagaaa
ctggtcgcctgcacccctcccaacaaggatggtaaagtaaacccactaaccctcgttgcc
ctcgatattgccgaatttgatgaggtttacaaggcaggcggagcgcaggcgatagcggcc
atggcatacggaaccgaaactgttgagaaggtttacaagattgtggggcctggaaacatc
tacgtcacagcggccaagcttcttgtggcaaaggatgtggcaatagacatgcctgcaggc
ccttcggaaattctcgttatagcggacgaaactgctaatgcggacttcatagcctgcgac
tgcctcgctcagcttgagcacgacccgatggcagtggctgtggttctcacaacctcccgg
aaagttgccgacgaggtggaaaaaaaggtcaaatcggaaggagatttcagcaacttcgcc
gttttcgttgttgaggacttggcggaggcctttgaaatttcgaacgaatttgctccggag
cacctcacggtagcggttaaaaatccggaggaatggctcgggaaagtcagaaatgctggc
agcgtttttctcggaaacttctctcccgtcgcagcaggagactacgcctctggaacgaac
cacgttttacccactgcaggctacgccaagatttacggcggcctgagcgttgagagcttt
ctgaagcacttcaccttccagatgctgagcgaggagagcatgaggagaattggaggggat
gtagtaaaaattgcagaagctgaagggttgaggtggcatgcggagagtgtgagaaaaagg
ttggaaaaaatttag

DBGET integrated database retrieval system