KEGG   Archaeoglobus fulgidus: AF0323bHelp
Entry
AF0323b           CDS       T00011                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
afu  Archaeoglobus fulgidus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AF0323b
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AF0323b
Enzymes [BR:afu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AF0323b
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
complement(292876..293373)
Genome map
AA seq 165 aa AA seqDB search
MLPGIVVKPLKTFADERGFFTEIMRRDWDVFEDEILQANMSVTYPGIVRAWHKHERGQVD
YFVCIGGAIKICAYDDETQELAEIVSTGKNLQVVRVPGHYWHGFKAIGVEPAVLVYFVSR
LYDYENPDEVRRPWNDSTIVPAKINGREDDPRCGKPWDWFYPPHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaggtatcgttgttaaaccgctcaaaaccttcgcagacgagaggggtttcttc
acggagataatgcgaagagactgggatgtttttgaggatgaaatccttcaggcgaacatg
tccgtgacctatccgggaatcgtgagggcttggcacaagcatgagagggggcaggtggac
tacttcgtctgcataggcggggcgataaagatatgtgcctacgatgatgaaactcaggag
ctggcagaaatagtttcgacgggcaaaaaccttcaggttgtgagggtgccgggacattac
tggcacggcttcaaggcgattggggtggagcctgcagtgctggtgtatttcgtcagcaga
ctgtatgactacgagaatcccgacgaggtgaggaggccctggaacgactccacaattgtg
cctgcaaagataaacggcagggaagacgaccctcgctgcggaaagccgtgggactggttt
tatcctccgcataaatga

DBGET integrated database retrieval system