KEGG   Archaeoglobus fulgidus: AF0323bHelp
Entry
AF0323b           CDS       T00011                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
afu  Archaeoglobus fulgidus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:afu00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:afu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
complement(292876..293373)
Genome map
AA seq 165 aa AA seqDB search
MLPGIVVKPLKTFADERGFFTEIMRRDWDVFEDEILQANMSVTYPGIVRAWHKHERGQVD
YFVCIGGAIKICAYDDETQELAEIVSTGKNLQVVRVPGHYWHGFKAIGVEPAVLVYFVSR
LYDYENPDEVRRPWNDSTIVPAKINGREDDPRCGKPWDWFYPPHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaggtatcgttgttaaaccgctcaaaaccttcgcagacgagaggggtttcttc
acggagataatgcgaagagactgggatgtttttgaggatgaaatccttcaggcgaacatg
tccgtgacctatccgggaatcgtgagggcttggcacaagcatgagagggggcaggtggac
tacttcgtctgcataggcggggcgataaagatatgtgcctacgatgatgaaactcaggag
ctggcagaaatagtttcgacgggcaaaaaccttcaggttgtgagggtgccgggacattac
tggcacggcttcaaggcgattggggtggagcctgcagtgctggtgtatttcgtcagcaga
ctgtatgactacgagaatcccgacgaggtgaggaggccctggaacgactccacaattgtg
cctgcaaagataaacggcagggaagacgaccctcgctgcggaaagccgtgggactggttt
tatcctccgcataaatga

DBGET integrated database retrieval system