KEGG   Archaeoglobus fulgidus: AF0340Help
Entry
AF0340            CDS       T00011                                 

Gene name
aor-3
Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
afu  Archaeoglobus fulgidus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:afu01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:afu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
311646..313442
Genome map
AA seq 598 aa AA seqDB search
MYGYCGKILRVDLSEKTVSTLIPEEKDLREFIGGAGYAVKLHYDMRSFEVDPLSPQNPLV
IVTGPLTATKAPSTSRLEFCARSPFTGIWGESNSGGRMAAYLKYAGWDGIIVEGASDKPV
LLKVDLTGAEILDAEHLWGKGCYETQEQIEKDLGEKRVATAVIGPAGENLVKYACIQVDN
SRHAGRTGVGAVMGSKKLKGIAVVYDPSERQRVEVADEEGFNRVVDEVLQRIKDDFTCNM
FTQLGTSGYMETAEGFGDLPIKYYTQGTWDGATKISGAAMAASVLRGNDGCLGCVVRCGR
VVEHKGKQIHGPEYETLAAFGALQLNDDLESLIEINYLVNDLGMDSISAGVSVAFAMYLT
EKGVGDFNIKWGDAEAVKQMVKDIACRRGKGEELAEGVRFIGLKYGKEAWSAHVKGLEIP
MHDARAFSSLAAAYATHPRGACHLPHQMYLYEMGKTISEYGIKSDDRFSNEGKGILAAKV
QNFSELFNAITMCAFMPVKPRHIAEMLRAVTGYNYTVENIYTAGERMFTLKRVYNVKCGV
KAEHDTLPEIVLQPLEGGSAGNVPDVKKQVSELYEFRKWPEGVPSREKLEELGLEWVE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctactgcggtaagattttgagggttgatttgtccgaaaaaacggtttcgact
ctcattccagaggagaaggatttgagggagttcattggtggtgcggggtatgcggtaaag
ctccactacgacatgagaagttttgaggttgaccccctttctccgcagaatccccttgtg
attgtgaccggcccgcttacggcaacaaaagccccctcaaccagtaggcttgagttctgc
gcccgcagccccttcacgggaatttggggtgagtccaactcaggcggaaggatggccgct
tacctcaaatacgcgggctgggacggcattattgtggagggggcgagcgataagcccgtt
cttctcaaggtagatttaaccggtgcggaaatccttgatgccgagcatttgtggggaaag
ggatgctacgagacacaggagcagattgagaaggatttgggagagaagagagtcgcaacg
gctgtgataggcccagctggcgagaatctggtgaagtacgcgtgcatccaggttgacaac
tcaaggcatgccggaagaacgggagtgggggctgtgatgggctcaaagaagctgaaaggc
attgctgttgtttatgatccgtcagaaaggcagagggttgaggttgcggacgaggagggc
tttaacagagtcgtcgatgaggttttgcagagaataaaggatgatttcacctgcaacatg
ttcacacagcttggaacttccggctacatggaaaccgccgaaggctttggtgacctgcca
atcaaatactacactcagggaacatgggatggggcaactaagatttccggtgcggcgatg
gcggcatcggttctaaggggaaacgatgggtgtttgggctgcgtcgttaggtgcggaagg
gttgttgagcacaagggaaagcagattcacgggccagaatacgagactcttgcggctttc
ggggctctccagctcaacgacgacctggagtcgctgattgagattaactacctcgtcaac
gacctcggaatggattccatctctgctggagttagcgtagcctttgccatgtacctcacc
gagaagggagttggagacttcaacatcaagtggggtgatgccgaggctgtgaagcagatg
gttaaggacatcgcctgcaggagaggcaaaggagaggagcttgcagagggtgtgaggttc
atcggcctgaagtacggcaaggaggcgtggagcgctcatgtaaaggggcttgagatacct
atgcacgatgcaagagccttcagcagccttgccgcggcttacgcaactcatccaaggggg
gcgtgccatttgccacatcaaatgtacctctacgagatgggaaagactattagcgagtat
ggcataaagagcgacgacaggttcagcaacgagggcaaaggaattcttgcggcaaaggtt
cagaacttctctgagcttttcaacgccatcacaatgtgcgccttcatgcccgtcaaaccg
agacacattgcagagatgctgagggcggttacgggctacaactacaccgttgagaacatc
tacactgcaggagagaggatgtttacactcaagagagtttacaacgtgaagtgcggggtt
aaggcggagcacgacaccctgcctgaaatagtcctccagccgcttgaaggcgggagcgcc
ggaaacgtgcctgatgtgaaaaaacaggtctcggagctttacgagttcagaaagtggcct
gagggtgtgccaagcagggagaagctggaggaactcggtttggagtgggttgaataa

DBGET integrated database retrieval system