KEGG   Archaeoglobus fulgidus DSM 4304: AF0356Help
Entry
AF0356            CDS       T00011                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AF0356
Enzymes [BR:afu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AF0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322387..323139
Genome map
AA seq 250 aa AA seqDB search
MGLSRLGIETAYIGKVGSDEEGRILLADFEREGVSTDFVIRAEGRSGTAMIFVDEKGNRA
ILVDPGVNDTIAYDEIDVDSARKYDLIHLTSFICKNGLDSLNSQKRIVEEFDSVSFDPGM
PYAERGLGDMEKILKNTTIFLPNRQEIEMLFSEDYRTAAERCIEMGIEIVAVKLGSEGCW
IKKGDREVTVKPVSTKVVDTTGAGDAFNAGFLYGYLKGKDIEECGRLGNFVAAKCIEKYG
AREGLPRSVD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtggggctttcgagactaggcattgagacagcatacataggtaaggtcggaagcgatgaa
gaaggcagaattctcctcgctgattttgaaagagagggcgtgagcacggatttcgtaatc
agggcggaggggagaagcggaactgccatgattttcgttgacgagaagggaaacagggcc
atcctcgtcgatcctggtgtgaacgacacaatagcctacgatgaaatcgacgtcgattca
gcgagaaagtacgacctcatccacctaacttccttcatatgcaagaacggtctggattcg
ctgaactcgcaaaaaaggatagttgaggagtttgatagtgtcagcttcgaccccggaatg
ccctacgctgagaggggactgggggacatggagaaaattctgaaaaacaccacgatattc
ctcccaaacaggcaggaaatcgagatgctcttttcggaggattacaggactgcagcggaa
cgctgcattgaaatgggtattgaaatagttgcggtcaagctcggctcggagggatgctgg
ataaaaaagggagacagggaagttaccgtaaagcccgtgagcacaaaggttgttgacaca
acgggtgcgggagatgctttcaacgccggattcctatatggatacctgaaaggaaaggac
atagaggagtgcggaaggctcggaaactttgttgcggcgaagtgcatagaaaagtacggt
gcaagagagggccttcctagaagtgtggattaa

DBGET integrated database retrieval system