KEGG   Archaeoglobus fulgidus DSM 4304: AF0366Help
Entry
AF0366            CDS       T00011                                 

Gene name
acs-2
Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF0366 (acs-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF0366 (acs-2)
   00620 Pyruvate metabolism
    AF0366 (acs-2)
   00640 Propanoate metabolism
    AF0366 (acs-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF0366 (acs-2)
   00680 Methane metabolism
    AF0366 (acs-2)
Enzymes [BR:afu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AF0366 (acs-2)
Lipid biosynthesis proteins [BR:afu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AF0366 (acs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331158..333203
Genome map
AA seq 681 aa AA seqDB search
MADPMEAMKKEFENRIIPPSWKDRVWEIEDYRKFHEDTIKDKESIEKWWEKWANEIFWFR
KWDRALDDSNPPFYRWFVGGETNLAYLCTDWQIEQGRKNKVAIIWEGEPVKENGEPVEVR
KLTYYDLYRESNRIAAMLKDKLGVKKDEILTFYLPMIPELPLFMLGVQRIGAKHSIVFSG
FSAQALAVRIMDAGARYVVTADGVYRRGKVLNLKAIVDDAVKICEQEGHKVEKVIVVKRA
GNEIPWNDSRDVWFEDLMADIGKNVKVECEKMGSEDFSFILYTSGTTGRPKGAQHSVGGY
AVHLYTTMKLIFDIKDDDIFWCTADIGWITGHSYIVYGPLMCGATTMMYEGAPDFPDVSR
WAAMIERYGVTIFYTAPTAIRMLMRFPEENYTKYDMSTLRIIHSVGEPINPEAWRWYYRV
FGREDVVCSSTWWMTETGGMLTDHFPGLGKIIPLKPGTNGYPIPGVRMEVLDDEGNSVKP
GERGYLVISTPWPGMLMTLFKDPNRFIDVYFGKYKSKGWYYYTGDFAMFDEDGYVWVLGR
ADDILKVAGHRIGTAEIESAMVSHPDVAEAACVGKSDPVKGEIPIIYVVLREGVEPSPDM
VNELKKHLRATLGPVVASDAVITFVNTLPKTRSGKIMRRLLRAVAEGKELGDVTTLESEV
AVEEAKKAYEMVKAALEGSKS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccgatggaagctatgaaaaaagagtttgagaaccgcatcattccaccaagc
tggaaggacagggtttgggaaatagaagattacaggaagttccacgaggacaccatcaag
gacaaggaatcgatagagaagtggtgggagaagtgggcaaacgagattttctggttcagg
aagtgggacagggctcttgacgatagcaacccgcccttctacaggtggtttgttggcgga
gagacgaatctcgcttacctctgtaccgactggcagattgagcagggaaggaagaacaag
gtggcgattatctgggaaggagagccggttaaggaaaatggagagccggttgaagtgaga
aagctaacttactacgacctttacagggaatcgaacaggattgccgcgatgctgaaggac
aagcttggagttaagaaggacgagatcctgaccttctacctgccaatgattcctgaactg
ccgcttttcatgcttggagtgcagagaataggggcgaagcacagcatagtgttcagcgga
ttcagtgctcaggctctggcggttagaataatggatgctggtgcgaggtatgttgtcact
gcagatggcgtttacaggagagggaaggtgctgaacctcaaagcgattgtagatgacgcc
gttaagatttgcgagcaggagggtcacaaggttgagaaggttatcgtggtcaagagagca
ggaaatgaaatcccgtggaacgatagcagagatgtttggtttgaggacctgatggcagac
attggaaagaacgtgaaggttgagtgcgagaaaatgggttctgaggacttcagcttcatc
ctatatacctcgggaaccacaggaaggccgaaaggagcgcagcactccgtcggaggctat
gcggttcacctctacactacaatgaagctcattttcgatatcaaggatgacgacatattc
tggtgcactgccgacatcggctggattacgggacacagctacattgtttacggtccactg
atgtgcggtgcgacgaccatgatgtatgaaggcgccccagacttccctgacgtgagcaga
tgggcagcgatgattgagcgctacggagtgacgatattctacaccgccccgacggcaata
agaatgctcatgcgcttccctgaggagaactacaccaagtacgacatgtcaacgctgaga
ataatccacagcgttggagagccgattaaccccgaagcttggagatggtactacagggtt
ttcggtagagaagatgttgtctgctcaagcacatggtggatgacggaaactgggggtatg
ctgacggaccacttcccaggattggggaagataattccacttaagccgggcacaaatggc
tatccaattcctggagttaggatggaggttcttgatgatgagggcaattctgtgaaaccg
ggagaaagaggctacctcgttatctccacaccatggcccggaatgctcatgacgctgttc
aaagacccaaacaggttcattgacgtttacttcggcaagtacaagagcaagggttggtat
tactacacaggcgactttgccatgttcgatgaggacggctacgtctgggttcttggaagg
gctgatgatatactgaaggttgctgggcacagaattggaactgctgaaattgaatcggca
atggtctctcatccggatgttgctgaagcagcctgcgttggcaaatccgacccggtaaag
ggagagattccgataatctacgtggtgctgagagaaggtgttgaaccctcaccggatatg
gtgaacgagctcaagaagcacctcagagccactctcggccctgttgttgccagcgatgct
gtgataaccttcgttaacactctacccaaaacaagaagcggtaaaatcatgaggaggctg
cttagggctgttgcagagggcaaagagctcggtgacgtcacaacccttgagagcgaggtt
gcggttgaggaggcgaagaaggcctacgagatggttaaggcggcccttgaggggtccaaa
tcctaa

DBGET integrated database retrieval system