KEGG   Archaeoglobus fulgidus: AF0401Help
Entry
AF0401            CDS       T00011                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
afu  Archaeoglobus fulgidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AF0401
Enzymes [BR:afu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AF0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
365321..366175
Genome map
AA seq 284 aa AA seqDB search
MFSAHAPALVDYIYLIDRYPQRGGHSIILSTRKSPGGAGANVAHNLASLGVESTLFTTLG
RDEDGIYFVENTLAKVKAEITDEKTGKVHVFVDGEGERTFFVEPNAAGKPFVEVDGGDYL
YLDPFPSEHSFEVQRKEAERFDGFVILNPGFPYSSLGFERLKQILQHVDMLIMSADEFSL
LGVETADVLRFVDYLIVTQGKLGSACYTKKGSFQSPAFPAKVADTTGAGDAFAAGFIYGF
IKNYPLEVCLTLGNFCGAYNVERVGARNFPSKSTIDEFLARVLR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttctcagcacacgctcctgcgcttgtggattatatctatctcatcgacaggtatcca
caaaggggcgggcacagcataatcctctccacccggaaatcgccgggtggtgcaggtgcg
aacgtggcccacaaccttgccagcctgggtgttgaatcaacgctcttcacgacactggga
agggacgaggacggaatttacttcgtcgagaacaccttggcgaaggtgaaagccgagata
actgatgagaaaacgggcaaagttcacgttttcgtcgatggggagggagagagaacgttt
tttgtagagccaaatgccgctggaaagccatttgttgaggtggatggcggggattacctc
tacctcgaccccttcccttccgagcacagctttgaagttcagagaaaggaggctgagaga
tttgatggctttgtaatactcaatcccggttttccctattcaagcctcggatttgaaagg
ctcaagcagattcttcagcacgtggacatgctcataatgtccgctgacgagttcagcctt
cttggtgttgagaccgcagacgtgctgagattcgtggactacctgattgtcacccagggg
aagctaggcagcgcttgctacaccaagaagggcagctttcagtccccagcatttccagcc
aaggttgctgacaccactggagcgggggatgccttcgctgctggcttcatctatggcttt
atcaaaaattaccccctcgaagtctgccttacgctgggaaacttctgcggagcttacaac
gtcgaaagggttggagcgagaaactttccatcaaagagcaccatcgatgaatttctcgca
agagttttaagatga

DBGET integrated database retrieval system