KEGG   Archaeoglobus fulgidus: AF0423Help
Entry
AF0423            CDS       T00011                                 

Gene name
dsrA
Definition
sulfite reductase subunit alpha
Orthology
K11180  
sulfite reductase alpha subunit [EC:1.8.99.3 1.8.99.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Nitrotoluene degradation
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Dissimilatory sulfate reduction, sulfate => H2S
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:afu00920]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:afu00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
381478..382734
Genome map
AA seq 418 aa AA seqDB search
MSETPLLDELEKGPWPSFVKEIKKTAELMEKAAAEGKDVKMPKGARGLLKQLEISYKDKK
THWKHGGIVSVVGYGGGVIGRYSDLGEQIPEVEHFHTMRINQPSGWFYSTKALRGLCDVW
EKWGSGLTNFHGSTGDIIFLGTRSEYLQPCFEDLGNLEIPFDIGGSGSDLRTPSACMGPA
LCEFACYDTLELCYDLTMTYQDELHRPMWPYKFKIKCAGCPNDCVASKARSDFAIIGTWK
DDIKVDQEAVKEYASWMDIENEVVKLCPTGAIKWDGKELTIDNRECVRCMHCINKMPKAL
KPGDERGATILIGGKAPFVEGAVIGWVAVPFVEVEKPYDEIKEILEAIWDWWDEEGKFRE
RIGELIWRKGMREFLKVIGREADVRMVKAPRNNPFMFFEKDELKPSAYTEELKKRGMW
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaactcctttgcttgatgaattagaaaaggggccttggccaagttttgtaaag
gaaatcaagaagacagcagaattgatggaaaaggctgctgccgagggtaaggatgtgaaa
atgccgaagggcgcaagaggcttgctcaagcagcttgaaatctcctataaagacaagaag
acgcactggaagcacggaggtattgtctcggttgtaggctacggtggaggtgttatcggc
aggtactccgacctcggagagcagattccagaagttgagcacttccacacaatgcgtata
aaccagccctcaggatggttctattcgacaaaggccctcagaggactttgtgacgtatgg
gagaagtggggaagcggtctgaccaacttccacggctcgactggagatatcatcttcctc
ggaacgaggagtgagtacctccagccgtgctttgaggacttgggtaacctcgaaatcccc
ttcgacattggaggaagcggctccgatctcagaacaccctcagcctgtatgggtccagca
ctctgtgagtttgcctgctacgatacgctggagctctgctacgacctcacaatgacctat
caggatgagcttcacaggcccatgtggccctacaagttcaagataaagtgcgccggctgt
ccgaacgactgtgttgcctcaaaggcgaggtcagacttcgccattatcggaacctggaag
gatgacatcaaggttgaccaggaggcagttaaggagtatgcatcctggatggacatcgag
aatgaggtcgtaaagctctgcccaactggagccatcaagtgggatgggaaggagctcacg
atcgacaacagagaatgtgtcagatgtatgcactgtataaacaagatgccaaaagctctc
aagccaggtgatgagagaggagcaacaatcctcatcggtggtaaggcacctttcgttgag
ggtgctgtcattggatgggttgcagttccattcgtagaggttgagaaaccctacgatgaa
atcaaggagattcttgaagccatctgggactggtgggacgaggaaggcaagttcagagaa
agaatcggggagttaatctggagaaagggaatgagggagttcctcaaggtcatcggcaga
gaagcagatgtgagaatggtgaaggcaccaagaaacaacccgttcatgttcttcgagaag
gacgagttgaagccgtcggcatatactgaagaattgaagaagagggggatgtggtaa

DBGET integrated database retrieval system