KEGG   Archaeoglobus fulgidus DSM 4304: AF0458Help
Entry
AF0458            CDS       T00011                                 

Gene name
pmm
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF0458 (pmm)
   00030 Pentose phosphate pathway
    AF0458 (pmm)
   00051 Fructose and mannose metabolism
    AF0458 (pmm)
   00052 Galactose metabolism
    AF0458 (pmm)
   00500 Starch and sucrose metabolism
    AF0458 (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    AF0458 (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    AF0458 (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AF0458 (pmm)
Enzymes [BR:afu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     AF0458 (pmm)
    5.4.2.8  phosphomannomutase
     AF0458 (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(414321..415661)
Genome map
AA seq 446 aa AA seqDB search
MRAGGAGELFGTNGVRGIANSELTADMALNLGRTIGTLRQGKIAIACDTRISSSMLKSAV
SAGIMSTGSDVVDIGIAPTPALQYYVKETDCSAGVIVTASHNPREYNGIKFVQENGVEFY
REMDEESERVYMSKKFRIAEWSEVGQLYQDNSGLRKYIEAIINSVELDKSYRVAVDCGNG
AGCFTTPEILKELGCDVYGINCNPDGRFPARNPEPVEASLDLLKKAVVDFRADFGVAHDG
DADRAVFVDEKGNFVNEDVMLALMAKHYVEKNGGGLVVTPVSSSKCVEDAVKMAGGEIIY
TAVGSPVVAKVMIEKEAVFGGEGNGGLIFPEHLIARDGGMSVAKVLELLDEKRKRLSELA
AEIPRYHIVKGKVECREKKRLLEGLKEEFPEANHIDGARIDFEDGWVLIRPSGTEPIARV
YAEAKTEDRARELYELGLRAIKKILG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaggaggagccggagagctttttggaaccaatggagttagagggattgcaaat
tccgagcttacagccgatatggctctaaaccttggcaggaccattggaacgctaaggcag
ggcaagatagccatcgcatgcgacacgagaatttcaagctcaatgctcaaatctgcagtt
tcggctggaataatgtccactggcagtgatgttgttgacatcggcattgcccccacaccg
gcccttcagtattacgtgaaggagacggactgctcagcaggggttatagtgactgcaagc
cacaatccgagagagtataacggcatcaagttcgttcaggagaatggggtggagttctac
agggagatggacgaggagagcgagagagtttacatgagcaagaagttcaggatcgcagaa
tggagcgaggtggggcagctttaccaagacaattcggggctgaggaagtacatagaggcc
atcatcaactcagttgagcttgacaaatcctacagggttgccgttgactgtggaaacgga
gctggctgcttcaccactcccgaaattctgaaggagcttggctgcgacgtttatggaata
aactgcaaccccgacggcagattccccgcaagaaatcccgagcctgtagaggcttcgctg
gatttgctgaagaaggctgttgttgacttcagggcagatttcggcgttgctcacgatgga
gatgctgatagagcggtttttgttgacgagaagggaaacttcgtcaatgaggatgtgatg
ctcgctctcatggcaaagcactacgttgagaagaatggaggggggttggtggtaactcca
gtctcatcctcaaaatgcgttgaagatgcggttaagatggctggtggagagattatttac
accgccgtaggctcgccagtggttgcaaaggtgatgattgaaaaggaagctgttttcggc
ggagagggaaatggtgggctgattttcccagagcatctcattgcgagagatggggggatg
agcgttgcaaaggttctggagcttcttgatgagaaaagaaagaggttgagcgagcttgcg
gctgagattccaagataccacattgtaaaaggcaaagtggagtgcagggagaagaagaga
ctgcttgaagggctgaaggaggagtttcccgaagccaatcacatcgatggagcgaggatt
gacttcgaggacgggtgggttttaattcgcccctcagggactgagcccattgcaagggtt
tatgcggaagcaaaaactgaggatagggcgagggagctttacgagctgggattgagggcg
ataaaaaagattttaggctaa

DBGET integrated database retrieval system