KEGG   Archaeoglobus fulgidus: AF0480Help
Entry
AF0480            CDS       T00011                                 

Gene name
fucA
Definition
fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
afu  Archaeoglobus fulgidus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(439304..439864)
Genome map
AA seq 186 aa AA seqDB search
MFRSFEIMFEEAIKVGKLLAAARLIDGASGNMSFKMADSIYITRSGENLDDLTDSSFVKI
KPGEFVKEASVDQLIHLKIYEKTDYNAVLHCHGVFNVVLGNKMDRIEPLDLEGKLYFGEV
EVVEGQFGSPELAEGIAEVVKRKGVAVVRNHGIYAAGKSLRDAYNKASYVEHSCEILYRS
MLLNKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgttcttttgaaatcatgttcgaagaggcgataaaggttggaaaacttctcgct
gcagctaggctaattgacggggcgagcggtaatatgagcttcaaaatggctgattcaatt
tacataacccgctccggtgagaatcttgatgacctaaccgattcatccttcgtcaaaatc
aagccgggagagtttgtgaaggaagcatcagttgaccagctaatccacctcaagatttac
gagaaaactgactacaacgctgtcctgcactgtcatggtgttttcaacgtggttttgggg
aacaaaatggacaggattgagccccttgatctggaaggcaagctttactttggcgaagtt
gaggttgttgaagggcagttcggctctccagagctcgctgaagggatagctgaggtagtg
aaaaggaaaggtgtggctgttgtaagaaatcacggaatctacgcagcaggaaagagcttg
agggatgcttacaacaaagcaagctacgttgaacactcctgtgaaatcctttaccgctca
atgctgctcaacaagctttag

DBGET integrated database retrieval system