KEGG   Archaeoglobus fulgidus DSM 4304: AF0551Help
Entry
AF0551            CDS       T00011                                 

Gene name
thrC-1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF0551 (thrC-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF0551 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AF0551 (thrC-1)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AF0551 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503163..504377
Genome map
AA seq 404 aa AA seqDB search
MYLVALKCRICGTEYPPEPLYHCSLCFGPLEAVYDYEGIKESVSKEEISKRVQSVWRYRE
FLPTNHDPVDLGAGFTRFIHAKNLGECLGLKNLYLLDDSTNPTYSFKDRVVSVAVTKALE
FGMDVVGCASTGNLAGSLAAHAAKAGLKAFIFVPAGIEKNKIVQALVHGATVVEVNGTYD
DANRLAAEIAEKNRNWGFVNINLRPYYVEGSKTLAFEAAERLGWEAPSQVVVPVASGALL
YSIYRGFKELETVGLIDSAEVAFNAAQPEGFPVARAVKERRQVEPIERFSTIVHSLAIGN
PADGIFAKEVVERSGGYAEDPSDAEVIEAVKLLARTEGIFTELAGGVTVAALIRLVEDGR
IDRDEKVVAYLTGNGLKTAEAVAETLSTVKIDARVEEFEKVLGR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtatctggtagcgttgaagtgcaggatatgtggaacggaatacccgcccgaacccctt
taccactgcagcctctgcttcgggccgctggaagccgtttacgattacgaggggataaag
gagagcgtgagtaaagaggagatttcgaagagagtgcagagcgtatggagatacagggag
tttttacccaccaaccatgatcccgttgacctcggagcaggatttacgagattcatacac
gcaaagaaccttggagagtgtctgggactaaagaacctctacctgctggacgattcgacc
aatccaacctactccttcaaggacagagtcgtgagcgttgcagtaaccaaggcgctggag
ttcgggatggatgttgttggatgcgcctctaccggaaacctcgccggaagcttggcagcg
cacgccgctaaggctggactgaaagctttcatattcgttcctgctggtatagagaagaac
aaaatcgttcaggctctcgtgcatggagctacggttgttgaggtaaatggaacctatgac
gacgccaacaggctcgctgcggaaatagcggagaagaacaggaactggggattcgtgaac
atcaacctccgcccctactatgtggagggaagcaaaacccttgcctttgaagctgcggag
aggcttggatgggaggccccatctcaggtggtggtgcccgtcgcatctggagcgctgctt
tactcgatttacagaggtttcaaagagcttgagacagttggacttatcgattcggctgaa
gttgctttcaacgccgcccagcctgagggatttccggtagcgagggctgtgaaggagaga
agacaggttgagccaatagagaggttcagcacgatagtccacagcctcgccatagggaat
ccagcggacggaatctttgcaaaggaggttgtggagagaagcggcggttacgctgaagac
ccgagcgacgctgaggttatcgaggctgtcaagctcctcgcgaggactgaggggattttc
accgagcttgctggaggtgtgacagttgctgctctaataaggctggttgaggacggcaga
attgacagagacgagaaggttgtggcgtatctcacaggaaacgggcttaaaacagctgaa
gctgtggcagagactctgagcaccgtaaagatagatgccagagtagaagagtttgagaag
gtcttggggaggtga

DBGET integrated database retrieval system