KEGG   Archaeoglobus fulgidus: AF0551Help
Entry
AF0551            CDS       T00011                                 

Gene name
thrC-1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF0551 (thrC-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF0551 (thrC-1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AF0551 (thrC-1)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AF0551 (thrC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
503163..504377
Genome map
AA seq 404 aa AA seqDB search
MYLVALKCRICGTEYPPEPLYHCSLCFGPLEAVYDYEGIKESVSKEEISKRVQSVWRYRE
FLPTNHDPVDLGAGFTRFIHAKNLGECLGLKNLYLLDDSTNPTYSFKDRVVSVAVTKALE
FGMDVVGCASTGNLAGSLAAHAAKAGLKAFIFVPAGIEKNKIVQALVHGATVVEVNGTYD
DANRLAAEIAEKNRNWGFVNINLRPYYVEGSKTLAFEAAERLGWEAPSQVVVPVASGALL
YSIYRGFKELETVGLIDSAEVAFNAAQPEGFPVARAVKERRQVEPIERFSTIVHSLAIGN
PADGIFAKEVVERSGGYAEDPSDAEVIEAVKLLARTEGIFTELAGGVTVAALIRLVEDGR
IDRDEKVVAYLTGNGLKTAEAVAETLSTVKIDARVEEFEKVLGR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtatctggtagcgttgaagtgcaggatatgtggaacggaatacccgcccgaacccctt
taccactgcagcctctgcttcgggccgctggaagccgtttacgattacgaggggataaag
gagagcgtgagtaaagaggagatttcgaagagagtgcagagcgtatggagatacagggag
tttttacccaccaaccatgatcccgttgacctcggagcaggatttacgagattcatacac
gcaaagaaccttggagagtgtctgggactaaagaacctctacctgctggacgattcgacc
aatccaacctactccttcaaggacagagtcgtgagcgttgcagtaaccaaggcgctggag
ttcgggatggatgttgttggatgcgcctctaccggaaacctcgccggaagcttggcagcg
cacgccgctaaggctggactgaaagctttcatattcgttcctgctggtatagagaagaac
aaaatcgttcaggctctcgtgcatggagctacggttgttgaggtaaatggaacctatgac
gacgccaacaggctcgctgcggaaatagcggagaagaacaggaactggggattcgtgaac
atcaacctccgcccctactatgtggagggaagcaaaacccttgcctttgaagctgcggag
aggcttggatgggaggccccatctcaggtggtggtgcccgtcgcatctggagcgctgctt
tactcgatttacagaggtttcaaagagcttgagacagttggacttatcgattcggctgaa
gttgctttcaacgccgcccagcctgagggatttccggtagcgagggctgtgaaggagaga
agacaggttgagccaatagagaggttcagcacgatagtccacagcctcgccatagggaat
ccagcggacggaatctttgcaaaggaggttgtggagagaagcggcggttacgctgaagac
ccgagcgacgctgaggttatcgaggctgtcaagctcctcgcgaggactgaggggattttc
accgagcttgctggaggtgtgacagttgctgctctaataaggctggttgaggacggcaga
attgacagagacgagaaggttgtggcgtatctcacaggaaacgggcttaaaacagctgaa
gctgtggcagagactctgagcaccgtaaagatagatgccagagtagaagagtttgagaag
gtcttggggaggtga

DBGET integrated database retrieval system