KEGG   Archaeoglobus fulgidus DSM 4304: AF0646Help
Entry
AF0646            CDS       T00011                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AF0646 (speB)
Enzymes [BR:afu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AF0646 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580593..581420
Genome map
AA seq 275 aa AA seqDB search
MHIDSYFSLSNCDAEEAEYLIYGIPYDATQSFKPGSRFAPNAIREASWNLESYSNLFDVE
LSLVKVGDAGNINCDGGFEQIVERTKEFLGEVEGFPVAIGGEHSISFAATSKFRKACFVV
FDAHFDLRDEFDGDRFNHACTTRRIFESGMRVAIFGVRSGIKEEKRFAEENGIKYLHAWD
FEVEKAVKMVEDFDKIYVSLDVDAFDPAFAPGVSTPEPFGLKPIDFIRFFAGIADRVVGF
DVVEVVPDSNKVTQTLAAKIILEAIAAKVRCDIPK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgattcctacttttccctttcaaactgcgatgccgaggaggctgaataccta
atctacggtatcccctacgacgcaactcagtcgttcaagcctggctctcgcttcgctccc
aacgcgataagagaggcaagctggaatctggagtcctattcgaacctttttgacgtggag
ctttcgctggtcaaagtgggcgatgcgggcaacataaactgcgatggcggttttgagcag
attgttgagagaacgaaggaatttcttggtgaagttgagggttttcccgtagccattggt
ggagagcactcaatcagctttgcagcaacgagcaagttcagaaaagcgtgcttcgtcgtt
ttcgatgcgcactttgatttgagagacgagttcgatggggacaggttcaaccacgcctgc
acaacgcggagaatctttgagagcgggatgcgggtggcaattttcggcgtcaggagcggt
attaaagaggagaagaggtttgcggaggaaaacggaataaaatacctccacgcgtgggac
tttgaggtcgagaaggcggttaaaatggtggaggactttgacaaaatctacgtttccctt
gacgtggacgctttcgaccccgccttcgctcccggcgtttcaacgcctgagccttttggt
ttgaagcctatagattttattaggttttttgcaggcatagcagacagagttgttggtttt
gatgttgtagaggttgttcccgactcgaacaaggttactcagactctcgctgcgaaaatc
atacttgaggccattgcggcaaaggtcaggtgtgatattccgaaataa

DBGET integrated database retrieval system