KEGG   Archaeoglobus fulgidus: AF0866Help
Entry
AF0866            CDS       T00011                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
afu  Archaeoglobus fulgidus
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(770576..772054)
Genome map
AA seq 492 aa AA seqDB search
MIGVIDAGTTTIKLAVYDEDKLVAIKKEPVVKHNPKPGWVEIDAEDLARKCVSFADTAID
EYGVEVIAITNQRTTAVLWDGKTGRPVFNALGWQDMRANALAEEMNRDSTIRMARTAGMI
ARGVVKLLPTLKNKRRVKWLITLSRLSIRPNHTSVKLCWMLRELGEKKEKYDLKAGTVDS
WLVYRLTGEHLTDYSNAAATGLYDSYYLRWSEPILKIVGADEEMLPKTLESDRIFGEYRN
VPVTGVIADQSASLYALGCWEEGDIKATNGTGTFVDLNVGEEPQASPGGLLPLIAWKLKS
EMRYMMEGMLFYSGSAVEKLKEIGIYDDVSKTSEMAFRSKNDDMLLIPSFTGLATPHYVS
VPGLLYGISNAMTREDIVKALLESIAFRIAEIVEIMRKEFPYETDRIRCDGEMSSNDFFL
QRIADVTGLKVERGAVLSGTSFGAHLVAGRALGKWKKDFCMPFDKVFEPSLDLSEKYRRW
KRLLEISKKLKV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgattggggtaatcgatgcgggaacaacaacgataaagcttgccgtttacgatgaggat
aaacttgtagcgatcaaaaaggagccggttgtcaagcacaatccaaagccgggatgggtt
gagatcgatgcagaggatttagcgaggaagtgtgtgagcttcgctgacacagccattgac
gagtatggtgttgaggtaattgccataaccaaccagcgaaccaccgcagttctgtgggat
ggtaaaacgggcaggccagtcttcaatgcccttggatggcaggacatgagggccaacgct
cttgctgaggagatgaacagagactctaccatcaggatggcaaggactgctggaatgatt
gcgagaggggtggtgaagctgcttccaacgctgaaaaacaagagaagggttaagtggctc
atcacactctcccgcctctcaatccgccccaaccacaccagcgtgaagctctgctggatg
ctgagggagcttggagagaaaaaggagaagtatgatctgaaagctggaaccgttgacagc
tggcttgtatacaggctgacaggtgagcatcttacagattactccaatgctgctgctaca
ggcctctacgactcctactacctgcggtggagcgagcccattctaaaaattgttggagca
gatgaggaaatgcttccgaaaaccctcgaaagcgacagaatctttggagagtacagaaat
gtgccagtcactggagtcatcgccgaccaatccgcctccctctacgccctcggatgctgg
gaggagggagacatcaaggccaccaacggaaccggaaccttcgtcgacctcaatgttgga
gaagagccccaagcctctcccggaggtttgcttcccctcatagcgtggaagctgaagtcg
gaaatgagatacatgatggaggggatgctcttctacagcggttctgccgtggagaagctg
aaggaaatcggcatctacgatgatgtttctaaaacttcagaaatggccttcaggtcgaag
aatgacgacatgctgctcatcccctccttcaccggcctcgcaactccccactacgtctcg
gttcccggcttgctttacgggatatccaacgccatgacgagggaggatatagtgaaagcc
ctgctcgaatccatagccttcagaatagccgaaatcgtcgagattatgcggaaggagttt
ccctacgaaactgacagaatcagatgcgacggagagatgtcctccaacgacttcttcctg
cagagaattgccgacgttacaggcttgaaagttgagaggggggcagtgctttcgggaact
tctttcggggcgcacctcgttgctgggagggctttgggcaagtggaaaaaggacttctgc
atgcccttcgataaagttttcgaaccctctttggatttatcggagaagtacagaaggtgg
aagaggctgcttgaaatatcgaaaaagcttaaggtgtga

DBGET integrated database retrieval system