KEGG   Archaeoglobus fulgidus: AF0904Help
Entry
AF0904            CDS       T00011                                 

Gene name
dapE-2
Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
afu  Archaeoglobus fulgidus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF0904 (dapE-2)
  Amino acid metabolism
   00300 Lysine biosynthesis
    AF0904 (dapE-2)
Enzymes [BR:afu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AF0904 (dapE-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
808086..809297
Genome map
AA seq 403 aa AA seqDB search
MRIVEAVEDFRDDMVKTLCDLIEIKAIAPEFGGDGEYKKAEYLMKHLEGFDSVERYDVED
DRVSDGVRPNIVAKVKGVLEKTIWIVAHLDVVPEGDERLWETPPFKGIVKNGRIYGRGSE
DNGQSLVSSLYAAKAIVESGLTPKYSLGLVYVADEEAGSNYGIKHLLKQNIFDREDMFVV
PDIGTPKGDMIEIAEKSILWLKFVVHGQQSHASMPSGLNANRRAMEFILDLDRKLHSKFN
ARNRLFVPPYSTFEPTKREKNVDNINTIPGLDVSYMDCRIIPDYDVEEVLDYIEDIRSFH
QMRGNSKIEIEVVQKVSSPPTPETAHIIERLRHTIEELRGFRPKVYGIGGNTCASFFRKS
GFTETAAWCTADGVAHQANEYCVIDNMVEDAKVFALLPFDPGY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgtggaggcggttgaagacttcagagatgacatggtcaaaacgctttgcgat
ttgattgaaataaaagccatagcccctgagttcggaggggacggggagtacaagaaggcg
gagtatttgatgaagcacctcgaaggttttgacagcgttgagaggtacgacgttgaggat
gacagagttagcgacggtgtgaggcccaacatagtcgccaaggttaagggcgtcctcgaa
aaaacaatctggattgttgcccatcttgacgtcgttcccgagggtgatgaaaggctgtgg
gaaactccacccttcaagggaatcgttaagaacggaaggatttacggaaggggaagcgag
gacaacggtcagagcttagtgtcatcgctttacgcagcgaaagccatcgttgaaagcggc
ctgactccaaagtacagcctcggccttgtttacgtggctgacgaggaggcgggaagcaac
tacggaataaagcaccttctcaagcagaacattttcgacagggaggacatgtttgtcgtt
ccggacatcggaacgcccaaaggggatatgatagagattgctgagaagagcattttgtgg
ctgaagttcgtcgttcacggtcagcagagccacgcaagcatgccgtcaggcctgaacgca
aacagaagggccatggagttcatacttgacctggacagaaagcttcattcgaagttcaac
gcaagaaacaggctattcgttccgccctactccactttcgagccaacaaagagggagaag
aatgtggacaacattaacaccattcccggcctcgacgtgagctacatggactgcaggata
attcctgactacgacgtggaggaggtgctggactacatagaggacatcaggagcttccac
cagatgaggggcaacagcaagattgaaattgaagtggtgcaaaaggtgtcctccccgcca
acccccgaaacagcccacataatcgaaaggctgagacacacgatagaggagctaagaggt
ttcaggccgaaggtttacggaattggcggcaacacatgcgcttcgtttttcaggaaaagc
ggtttcaccgaaactgctgcatggtgcaccgcagacggtgtcgctcaccaggcaaacgag
tactgcgtaatagacaacatggttgaggacgcaaaggttttcgcccttctgcccttcgat
ccgggatattag

DBGET integrated database retrieval system