KEGG   Archaeoglobus fulgidus: AF1038Help
Entry
AF1038            CDS       T00011                                 

Definition
hypothetical protein
Orthology
K03411  
chemotaxis protein CheD [EC:3.5.1.44]
Organism
afu  Archaeoglobus fulgidus
Pathway
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:afu00001]
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AF1038
Enzymes [BR:afu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AF1038
Bacterial motility proteins [BR:afu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AF1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(945172..945645)
Genome map
AA seq 157 aa AA seqDB search
MGSEILVGIGEFRVAKGAVLKTIGLGSCVGIALYDPKLRLGGLAHVMLPQSGNGTKRSAK
YADHAVEMMTEAMERLGSDRKRIVAKMAGGAQIFKHMTMDMLRIGDRNAEAIRTILRDYG
IRIVSEDLGGDEGRTVYFFTNDGRMLVKYSRGGELWI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgagatactggtgggcataggggagttcagggtagccaagggtgcggtgctg
aaaacaattggattgggctcctgcgtaggcattgcgctgtacgacccaaagctgaggctg
ggtggtctggctcacgtaatgctcccgcagtcgggcaacggcaccaagaggagtgccaag
tacgcagaccatgcggtggaaatgatgaccgaagcgatggaaaggctgggaagtgacagg
aaaaggatagttgcgaagatggcaggaggtgcgcagattttcaagcacatgacgatggac
atgctcagaatcggcgacaggaacgctgaagccatcaggacgatactgagggattacggc
atcaggattgtgtcggaagatttggggggtgacgaggggagaaccgtctatttttttaca
aatgatggaaggatgctggtcaaatacagcaggggtggagagttgtggatttag

DBGET integrated database retrieval system