KEGG   Archaeoglobus fulgidus: AF1038Help
Entry
AF1038            CDS       T00011                                 

Definition
hypothetical protein
Orthology
K03411  
chemotaxis protein CheD [EC:3.5.1.44]
Organism
afu  Archaeoglobus fulgidus
Pathway
Bacterial chemotaxis
Class
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:afu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(945172..945645)
Genome map
AA seq 157 aa AA seqDB search
MGSEILVGIGEFRVAKGAVLKTIGLGSCVGIALYDPKLRLGGLAHVMLPQSGNGTKRSAK
YADHAVEMMTEAMERLGSDRKRIVAKMAGGAQIFKHMTMDMLRIGDRNAEAIRTILRDYG
IRIVSEDLGGDEGRTVYFFTNDGRMLVKYSRGGELWI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgagatactggtgggcataggggagttcagggtagccaagggtgcggtgctg
aaaacaattggattgggctcctgcgtaggcattgcgctgtacgacccaaagctgaggctg
ggtggtctggctcacgtaatgctcccgcagtcgggcaacggcaccaagaggagtgccaag
tacgcagaccatgcggtggaaatgatgaccgaagcgatggaaaggctgggaagtgacagg
aaaaggatagttgcgaagatggcaggaggtgcgcagattttcaagcacatgacgatggac
atgctcagaatcggcgacaggaacgctgaagccatcaggacgatactgagggattacggc
atcaggattgtgtcggaagatttggggggtgacgaggggagaaccgtctatttttttaca
aatgatggaaggatgctggtcaaatacagcaggggtggagagttgtggatttag

DBGET integrated database retrieval system