KEGG   Archaeoglobus fulgidus DSM 4304: AF1240Help
Entry
AF1240            CDS       T00011                                 

Gene name
trpB-1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF1240 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF1240 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AF1240 (trpB-1)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AF1240 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1107270..1108577)
Genome map
AA seq 435 aa AA seqDB search
MLSWCMKKIMLDESEMPKEWYNVLPDLPEPLPPPLHPATQEPVKPEDLEPIFPKGLIQQE
MSGERWIRIPEDVREIYRIWRPTPLVRAERLEKALKTPARIYFKYEGASPPGSHKPNTAV
AQAYYNAKEGVERLTTETGAGQWGSALCFATKLFEMACTVYMVKVSFMQKPYRRVMMETW
GGEVIPSPSDRTEVGRKILAENPDTPGSLGIAISEAIEDAAKNENTKYSLGSVLNHVLLH
QTVIGLETKAQLEKVDEKPDVLIGCVGGGSNFAGLTYPFVNDAKNGDLEIIAVEPAACPT
LTAGEYKYDFGDVAGLTPLLKMYTLGHDFIPPPIHAGGLRYHGDAPTLCMLVKHGVIKAR
AVKQLPTFEAGLLFARTEGIIPAPETNHAVRAAIDEAIKARENNEEKVIVFGFSGHGLLD
LQAYDDYLAGRLADT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatggtgcatgaaaaagataatgcttgatgagagcgagatgccgaaggagtgg
tacaacgttctgcccgatctgcccgaacctctccctccaccgctccatcccgcaacgcag
gagcctgtaaagccagaagatttggagccgatttttccgaaagggctgattcagcaggag
atgagtggcgagaggtggataaggattccggaggatgtaagggaaatttacagaatctgg
cgtccaacacctctggtaagggctgagaggcttgaaaaggctctgaaaactccagcaagg
atttatttcaagtacgagggggcaagccctccgggcagccacaagcccaacaccgccgtt
gcgcaggcctactacaacgcgaaggagggagttgagagactcaccactgaaaccggagcg
ggacagtggggttcagctttgtgcttcgcaacgaagctcttcgagatggcgtgcacggtt
tacatggttaaagtaagcttcatgcagaagccctacaggagggtgatgatggagacgtgg
ggtggagaagtcattccatctcccagcgacagaacggaagtgggcaggaagattcttgca
gagaatcccgacacgccggggagtttgggtatagccattagcgaggccattgaggatgct
gccaaaaacgagaacaccaagtacagccttggaagcgttctgaaccacgtcctgcttcac
cagactgttattggccttgaaaccaaggcgcagcttgagaaggttgatgagaagcctgac
gtgctgattggctgtgtgggtggtggtagcaactttgcaggcctcacttaccccttcgtt
aacgacgcgaagaatggtgatctggaaatcatcgctgttgagcccgctgcctgccccacg
ttgacggcaggagagtacaagtacgatttcggtgatgttgcaggcctgacaccccttctg
aagatgtacaccctcggccacgacttcatcccacctccaatccacgctggtgggcttagg
taccacggtgacgctccaacactctgcatgcttgtcaagcacggcgtaattaaggcaagg
gcggtgaagcagcttccaacattcgaggccgggttgctcttcgccagaacggagggcata
atccccgctccggaaaccaaccacgcagtgagggcggcgattgatgaggccattaaggcg
agggagaacaacgaggagaaggtaatcgtcttcggcttcagcggtcacggattgcttgac
ttgcaggcttacgacgactaccttgcgggaaggcttgccgacacttag

DBGET integrated database retrieval system