KEGG   Archaeoglobus fulgidus: AF1240Help
Entry
AF1240            CDS       T00011                                 

Gene name
trpB-1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF1240 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF1240 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AF1240 (trpB-1)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AF1240 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1107270..1108577)
Genome map
AA seq 435 aa AA seqDB search
MLSWCMKKIMLDESEMPKEWYNVLPDLPEPLPPPLHPATQEPVKPEDLEPIFPKGLIQQE
MSGERWIRIPEDVREIYRIWRPTPLVRAERLEKALKTPARIYFKYEGASPPGSHKPNTAV
AQAYYNAKEGVERLTTETGAGQWGSALCFATKLFEMACTVYMVKVSFMQKPYRRVMMETW
GGEVIPSPSDRTEVGRKILAENPDTPGSLGIAISEAIEDAAKNENTKYSLGSVLNHVLLH
QTVIGLETKAQLEKVDEKPDVLIGCVGGGSNFAGLTYPFVNDAKNGDLEIIAVEPAACPT
LTAGEYKYDFGDVAGLTPLLKMYTLGHDFIPPPIHAGGLRYHGDAPTLCMLVKHGVIKAR
AVKQLPTFEAGLLFARTEGIIPAPETNHAVRAAIDEAIKARENNEEKVIVFGFSGHGLLD
LQAYDDYLAGRLADT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatggtgcatgaaaaagataatgcttgatgagagcgagatgccgaaggagtgg
tacaacgttctgcccgatctgcccgaacctctccctccaccgctccatcccgcaacgcag
gagcctgtaaagccagaagatttggagccgatttttccgaaagggctgattcagcaggag
atgagtggcgagaggtggataaggattccggaggatgtaagggaaatttacagaatctgg
cgtccaacacctctggtaagggctgagaggcttgaaaaggctctgaaaactccagcaagg
atttatttcaagtacgagggggcaagccctccgggcagccacaagcccaacaccgccgtt
gcgcaggcctactacaacgcgaaggagggagttgagagactcaccactgaaaccggagcg
ggacagtggggttcagctttgtgcttcgcaacgaagctcttcgagatggcgtgcacggtt
tacatggttaaagtaagcttcatgcagaagccctacaggagggtgatgatggagacgtgg
ggtggagaagtcattccatctcccagcgacagaacggaagtgggcaggaagattcttgca
gagaatcccgacacgccggggagtttgggtatagccattagcgaggccattgaggatgct
gccaaaaacgagaacaccaagtacagccttggaagcgttctgaaccacgtcctgcttcac
cagactgttattggccttgaaaccaaggcgcagcttgagaaggttgatgagaagcctgac
gtgctgattggctgtgtgggtggtggtagcaactttgcaggcctcacttaccccttcgtt
aacgacgcgaagaatggtgatctggaaatcatcgctgttgagcccgctgcctgccccacg
ttgacggcaggagagtacaagtacgatttcggtgatgttgcaggcctgacaccccttctg
aagatgtacaccctcggccacgacttcatcccacctccaatccacgctggtgggcttagg
taccacggtgacgctccaacactctgcatgcttgtcaagcacggcgtaattaaggcaagg
gcggtgaagcagcttccaacattcgaggccgggttgctcttcgccagaacggagggcata
atccccgctccggaaaccaaccacgcagtgagggcggcgattgatgaggccattaaggcg
agggagaacaacgaggagaaggtaatcgtcttcggcttcagcggtcacggattgcttgac
ttgcaggcttacgacgactaccttgcgggaaggcttgccgacacttag

DBGET integrated database retrieval system