KEGG   Archaeoglobus fulgidus: AF1304Help
Entry
AF1304            CDS       T00011                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF1304 (tpiA)
   01230 Biosynthesis of amino acids
    AF1304 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF1304 (tpiA)
   00051 Fructose and mannose metabolism
    AF1304 (tpiA)
   00562 Inositol phosphate metabolism
    AF1304 (tpiA)
Enzymes [BR:afu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AF1304 (tpiA)
Exosome [BR:afu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AF1304 (tpiA)
  Exosomal proteins of bladder cancer cells
   AF1304 (tpiA)
  Exosomal proteins of melanoma cells
   AF1304 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1163419..1164090)
Genome map
AA seq 223 aa AA seqDB search
MRKMGVVIINFKAYKEGFGKRALELAKIAENVASRCDEYVGIAVSFLDLPVIAREVSIDV
YAQHVDAVGFGSHTGRINADMIAEYGAKGSLVNHSERRLKLADIEFNVSRLRELGLTSVV
CTNNVPTTAAAAALNPDFVAVEPPELIGSGIPVSKAEPEVVENSVKAAKEVNKSVRVLCG
AGITTHEDYVKALELGAEGVLLASGVVKAEDQKRALEELVGLL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaatgggggttgtgataataaacttcaaggcgtataaggagggatttggaaaa
agggcgcttgagctggcgaagattgccgaaaacgtggcgtcgagatgcgatgagtatgtt
ggcatagccgtctccttcctcgacctccccgtaatcgcaagggaggtcagcatcgacgtt
tacgcgcagcatgttgatgccgttggcttcgggagccacacaggcagaataaacgccgat
atgatcgcggaatacggggcaaagggaagcttggtcaatcattctgagagaaggctgaag
ctcgccgatattgagttcaacgtgagcaggctgagggagcttggtctcacttcggttgtc
tgcacgaacaacgtcccaacaacagccgcggcggcagcgttgaatccggactttgtcgcg
gtggagccacctgagctgataggtagcggaattccggtaagcaaggccgaacccgaggtt
gtggagaactcagttaaggctgcaaaggaagtcaacaagagcgttagagttctttgtggg
gcgggcataaccacccatgaggactacgtaaaagcattggagctcggagcagagggtgtg
ctactcgcgagtggggttgttaaggccgaagaccagaagagggcacttgaggagctcgta
gggcttctttag

DBGET integrated database retrieval system