KEGG   Archaeoglobus fulgidus: AF1304Help
Entry
AF1304            CDS       T00011                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:afu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afu00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afu00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:afu00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1163419..1164090)
Genome map
AA seq 223 aa AA seqDB search
MRKMGVVIINFKAYKEGFGKRALELAKIAENVASRCDEYVGIAVSFLDLPVIAREVSIDV
YAQHVDAVGFGSHTGRINADMIAEYGAKGSLVNHSERRLKLADIEFNVSRLRELGLTSVV
CTNNVPTTAAAAALNPDFVAVEPPELIGSGIPVSKAEPEVVENSVKAAKEVNKSVRVLCG
AGITTHEDYVKALELGAEGVLLASGVVKAEDQKRALEELVGLL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaatgggggttgtgataataaacttcaaggcgtataaggagggatttggaaaa
agggcgcttgagctggcgaagattgccgaaaacgtggcgtcgagatgcgatgagtatgtt
ggcatagccgtctccttcctcgacctccccgtaatcgcaagggaggtcagcatcgacgtt
tacgcgcagcatgttgatgccgttggcttcgggagccacacaggcagaataaacgccgat
atgatcgcggaatacggggcaaagggaagcttggtcaatcattctgagagaaggctgaag
ctcgccgatattgagttcaacgtgagcaggctgagggagcttggtctcacttcggttgtc
tgcacgaacaacgtcccaacaacagccgcggcggcagcgttgaatccggactttgtcgcg
gtggagccacctgagctgataggtagcggaattccggtaagcaaggccgaacccgaggtt
gtggagaactcagttaaggctgcaaaggaagtcaacaagagcgttagagttctttgtggg
gcgggcataaccacccatgaggactacgtaaaagcattggagctcggagcagagggtgtg
ctactcgcgagtggggttgttaaggccgaagaccagaagagggcacttgaggagctcgta
gggcttctttag

DBGET integrated database retrieval system