KEGG   Archaeoglobus fulgidus DSM 4304: AF1316Help
Entry
AF1316            CDS       T00011                                 

Gene name
thrC-2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF1316 (thrC-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF1316 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AF1316 (thrC-2)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AF1316 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173643..1174833
Genome map
AA seq 396 aa AA seqDB search
MYRLKCIECGKEWGDENYTCECGGLLEVEIDLDEVEIDFRLDGSNITVWKYRSLLPVKID
PVTLKEGGTPLYRAERLEKEVGVRRVYVKHEGLNPSGSFKDRGMTVGVTKALELGRKAVA
CASTGNTSASMAMYAAKAGLKAYVLLPAGKVALGKVAQALMHGAKVIGIDGNFDDALRIV
REVCSREPIYLLNSINPFRPEGQKTIAYEIADEIGVPDRVVLPVGNAGNISAIYKGFKEL
REVGLTDSMPKMTGIQAEGAAPIYRAFKEGKEDITPMENPETIATAIRIGNPVSAKKALR
AIYSTNGLAEVVSDSEIIEAQKFLAAKEGIGVEPASAASVAGLRKLAANGMLDPDETIVC
VVTGNLLKDPETVVRVCGEPVKVEASVEAVIRAMRA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtctgaagtgcattgaatgcgggaaggaatggggcgatgaaaactacacctgc
gagtgtggagggcttctggaggttgaaatagaccttgatgaggttgaaattgacttcagg
cttgatggaagcaacatcacggtctggaagtaccgctctctcctccccgttaaaattgac
cctgtcacgctgaaggagggtggaactcctctttacagggccgagaggcttgagaaggag
gttggtgtgaggagagtttatgttaagcacgaaggtctgaacccctcaggctccttcaag
gacagggggatgactgtaggagtgaccaaagcccttgagcttgggagaaaagctgttgcg
tgtgcatcaacaggcaacacctcagcctcaatggcgatgtatgcggcaaaggcggggcta
aaggcctacgtcctgcttcctgcaggcaaggtggcgctgggaaaggttgctcaagcttta
atgcacggggcgaaggttataggaatcgacgggaacttcgatgacgcgctcagaattgtg
agggaagtttgcagcagggagccaatctacctcctgaactccatcaaccccttcaggcct
gaggggcagaagaccatcgcctacgagattgcagatgaaattggtgtgcccgacagagtt
gttctgcctgtggggaatgccgggaacatatcagcaatctacaagggatttaaggagctc
agagaggttggtttgacagattcaatgcccaaaatgacggggattcaggctgagggagcg
gcgccgatttacagggcttttaaagagggaaaagaggacataacacctatggagaatccg
gaaaccatagcgacggccataagaatagggaatccagtcagcgcgaaaaaggctttaagg
gccatctacagcacaaacgggctggcagaggttgttagcgattcagaaatcatcgaggcg
cagaagttcttagctgcgaaggagggcataggggttgagccagcctcagcggcaagcgtt
gcggggctgagaaagctcgcagccaatggtatgctcgacccggatgaaaccatcgtgtgt
gttgtgacgggcaatttactcaaagacccggagactgttgtgagggtttgcggagagccg
gtgaaagttgaggcgagcgttgaggctgtaatcagggcgatgagggcttga

DBGET integrated database retrieval system