KEGG   Archaeoglobus fulgidus DSM 4304: AF1341Help
Entry
AF1341            CDS       T00011                                 

Gene name
deoA-1
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
Enzymes [BR:afu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     AF1341 (deoA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198851..1200365)
Genome map
AA seq 504 aa AA seqDB search
MIFKAVRVPFKSGRFAVILNEEDASELGVREGDRVRVRYGKAGVVATVQITREIVEKGFV
GLTDLASMELGISDGAEVDVFPSPKPKSVELIKKKTRGEKLSQDEIRRIVEDITNNALSE
VELTAFVISSMLRGMDFDEIEWLTRSMIETGERIEFDRGTVVDKHSIGGVPGNKISLLIV
PTVAAAGLLIPKTASRAITSASGTADTMEVLANVNLSVDEIKEITERVGGVIAWGGATNI
APADDKIIRVEHPLSIDPRPQLLASVMAKKGSVGAKHVVIDIPVGEGAKIEKVEVGRSLA
NDFIELGRRLGLNVMAAITYGGQPVGRAIGPALEAREALKTMEDRRGPSSLVEKSLGIAG
ILFEMTGIATNGYQHARKIFESGKTLEKFREIVAAQGGDESVKAEDVAVGDKTYTLTSQV
EGAVVSVNNKSIVKIARTAGAPKDKGAGVYVHKKRGEVVKVGDPLLTIYAEKEWKLDNAI
EVANTERPIVVSGMVLEVYGRRGV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaaggcggttagagttccattcaagtcgggaaggtttgccgtgattcttaac
gaagaggatgcaagcgagcttggcgtcagagagggggatagagtcagggtgaggtacggc
aaggcgggggttgtcgccacagtacagataacgagggaaatcgttgagaagggctttgtc
ggattaacagacctcgcttcaatggagcttggaatatcggacggtgctgaggttgatgtg
tttccatctccgaaaccaaaaagcgttgagctgataaagaagaagacgaggggcgagaag
ctgagccaggatgaaatcaggaggatagttgaggacataaccaacaacgctctgagcgag
gttgagctcacagcctttgtcatttcttcgatgcttcgcgggatggattttgacgaaata
gagtggttaacgaggtcgatgattgaaaccggagagaggattgagtttgacaggggaacg
gttgtggacaagcacagcattggcggtgtgccgggcaacaagatatccctgctcatcgtt
ccgactgttgctgcggcggggctcttaattccgaagacagcaagcagagcgataacgtca
gccagcggaacggcagacactatggaggttctcgcaaacgtcaatctgagcgttgacgag
ataaaggagattacggagagagtggggggagtcattgcctggggaggggcgacgaacata
gctccggcagatgataaaataataagggtcgaacatcccctctccatcgatcccagaccg
cagcttcttgccagcgttatggccaagaagggctcggttggagcgaagcatgtcgtaatc
gacattcccgttggggagggggcaaagattgagaaggtggaggtcggcaggtctctggca
aacgacttcattgagctcggcagaaggctcgggcttaacgtcatggcggcaataacctac
ggaggtcagcccgtgggaagggctattggccccgcgctggaagcaagggaagcgcttaag
acgatggaggacagacgaggtccttcgagtctggttgagaagtcccttggcatagcggga
atactcttcgagatgaccggcatagccacaaacggctatcagcatgccaggaagatattc
gagagcggaaaaacgcttgagaagttcagggagattgttgcggctcagggaggagatgag
agcgttaaggccgaggacgtggcggtgggagataagacctacacactcacctctcaggtg
gaaggggcggtggtttcggtaaacaataaaagcatcgtgaaaatagcgagaacagcaggc
gctcccaaggacaagggagcgggagtttatgtccacaagaagaggggtgaggttgtaaag
gtcggagacccgcttctcaccatctacgccgagaaggagtggaagctcgacaacgcaata
gaggttgcgaacaccgagaggccaattgtggtttcgggaatggtgctggaagtttacgga
agaagaggtgtgtaa

DBGET integrated database retrieval system