KEGG   Archaeoglobus fulgidus DSM 4304: AF1342Help
Entry
AF1342            CDS       T00011                                 

Gene name
deoA-2
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AF1342 (deoA-2)
Enzymes [BR:afu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AF1342 (deoA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200362..1201879)
Genome map
AA seq 505 aa AA seqDB search
MKFRIKTLPLRTERIAVVLSQDDAAELGLLPGDRVKVSYDGKSFVAEVEISQEFISSGEA
GVCTFTAETCSLSEECVVEIVPFARPKSVEYIRKKLNGAKYEREEIKDIIGSISSDVLSD
IEISAFILANEIVGMQNDEIQWMIEAMVEVGERVVFERGTVVDMHSIGGLPGNRFSLIAV
PTVAAAGLLIPKTASRAITTASGTADTMEVLANVNLSVDEIKEITEEVGGVIAWNAPTGI
APADEKIIRVEYQLELSPKPHLMASVLSKKLGSGARFVAIDIPVGKKAKVENVDVGRGFA
NAMMEIGRNLNLKVATALTDGSQPLGRAIGPALEAREVLEVMERKVEGDLLEKSLGIAGI
LFEMTGIATNGYQHARKIFESGKTLEKFREIVAAQGGDESVKAEDVAVGDKTYTLHAAKE
GYVREIDIAALNEIARTAGAPKDKGAGVYVHKKRGEVVKVGDPLLTIYAEKEWKLDNAIE
VANTKQAFEISGVIIERYTMGRWWS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaggataaagaccttgcccctcagaaccgaaaggattgctgttgttctgagt
caggatgacgcggctgaactcggtctccttccgggagacagagtgaaggttagctatgac
ggcaaatcattcgtagcggaggttgagatctctcaggagttcattagcagtggggaagct
ggagtttgcaccttcaccgccgagacgtgcagcctttccgaggagtgcgtggttgagatt
gttcccttcgccaggccgaagtcggtcgaatacataagaaagaagcttaacggagctaaa
tacgaaagagaggagattaaggacataattggcagcatctcatctgacgtactctcggac
attgaaatctctgcattcatacttgcaaacgagattgtagggatgcagaacgacgagatt
cagtggatgatcgaggcgatggtcgaagtcggagaaagggtagttttcgaaaggggaacg
gttgtggacatgcacagcattggagggttgcccggaaacaggttttcgctgattgccgtc
cccacggttgctgcggcggggctcttaattccgaagacagcaagcagagccataaccact
gcaagcggaacggcagacactatggaggttctcgcaaacgtcaatctgagcgttgacgag
ataaaggagattaccgaggaagttggaggggttatagcatggaacgcccccacgggaatt
gccccggctgatgagaaaataataagggtcgaataccagctggagctaagcccaaaaccg
catctaatggccagtgtgctgtccaaaaagctgggaagcggtgcaagattcgtcgccatc
gacattccggttggaaagaaggccaaggtcgagaacgttgacgtcggaagaggcttcgca
aatgctatgatggaaattgggaggaacttgaacctcaaggttgcaacggctctgacagat
ggctctcaaccccttggaagggctattggccccgcgctggaggcgagagaggttctcgaa
gttatggagaggaaggttgaaggggacttgcttgagaagtcccttggcatagcgggaata
ctcttcgagatgaccggtatagccacaaacggctatcagcatgccaggaagatattcgag
agcggaaaaacgcttgagaagttcagggagattgttgcggctcagggaggagatgagagc
gttaaggccgaggacgtggcggtgggggataagacctacactctccacgctgcgaaggag
ggttacgttagggaaatagacatagcagcccttaacgaaatagcaaggacagcaggagcc
cccaaggacaagggagcgggagtttatgtccacaagaagaggggtgaggttgtaaaggtc
ggagacccgcttctcaccatctatgctgagaaggagtggaagctcgacaacgcaatagag
gttgcgaacaccaagcaggccttcgagatttcaggggttattatagagaggtacacgatg
ggaaggtggtggtcatga

DBGET integrated database retrieval system