KEGG   Archaeoglobus fulgidus: AF1442Help
Entry
AF1442            CDS       T00011                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF1442
   01230 Biosynthesis of amino acids
    AF1442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF1442
   00030 Pentose phosphate pathway
    AF1442
   00051 Fructose and mannose metabolism
    AF1442
  Energy metabolism
   00680 Methane metabolism
    AF1442
Enzymes [BR:afu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AF1442
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     AF1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1299714..1300826)
Genome map
AA seq 370 aa AA seqDB search
MRKVTVSLIKADVGSVAGHTTVPDELKKAAEENLKNAVDSGLIIDFRVFNAGDDLELLMT
HDKGVDSEEIHRLAWETFEKAAGIAKELKLYGAGQDLLKDAFSGNVRGLGPGVAEMEFTE
RKAEPVIAFMMDKTEPGAFNMPIFRMFADPFNTAGLVIDPTMHQGFVFEIWDIKESKRVF
MRTPEEMYDILALIGGKSRFVIKRVYPKEGGKLPADEPVAVISTEKLYEVAGEYVGKDDP
VALVRAQSGLPAVGEVLEPFAFPHLVSGWMRGSHNGPIMPVPFKYSKCTRFDGPPRCIAA
GFQLANGKIIGPVDMFDDPAFDYTRQKAMEIAEYMRRHGPFEPHRLPSEDMEYTTLPKVL
EKLKGRFEEV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaagtaaccgtttctctgataaaagcggatgttggtagcgtcgctgggcacaca
acggttcccgatgagctgaaaaaagccgctgaagagaatttgaaaaacgctgttgattct
ggccttattattgattttagagtattcaacgctggagatgacctcgaactgctgatgacc
cacgataagggcgttgacagcgaagagatccacaggctcgcatgggagacttttgagaag
gctgcaggcattgcaaaggagctgaagctttacggtgcgggacaggatttgctcaaggat
gccttctcgggcaacgtcagaggcttggggccaggagtagcagagatggagttcacagaa
agaaaggcggagccagtaatagccttcatgatggataaaaccgagcccggagccttcaac
atgccaatcttcaggatgttcgctgaccccttcaacaccgctggtctggttatagacccc
acaatgcatcagggctttgtattcgagatatgggatatcaaggagagcaagagggttttc
atgaggactcctgaggagatgtacgacattctcgccctgattggagggaagagcaggttt
gtaatcaagagagtctatccaaaagagggcggaaagcttcctgctgacgagcccgttgcg
gtaatcagcacagaaaagctctacgaggttgcgggagagtatgttggtaaggatgatcct
gttgcactggtgagggctcagagcgggttgcctgcagttggagaggttcttgagcccttc
gccttcccccacctcgtgagcgggtggatgagggggagccacaatgggccgatcatgcca
gtgcccttcaaatactccaaatgcacgcgctttgacggcccacctcgctgtatagccgca
ggcttccagcttgccaatggaaagattattggcccggtggacatgttcgacgacccggcc
ttcgactacacgaggcagaaggcaatggagattgccgaatacatgcgccgccatggcccc
ttcgagccgcacagactgccgagcgaggatatggagtacacaaccctccccaaagttctt
gaaaagctgaaggggaggttcgaagaagtctga

DBGET integrated database retrieval system