KEGG   Archaeoglobus fulgidus: AF1445Help
Entry
AF1445            CDS       T00011                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AF1445
Enzymes [BR:afu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AF1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1302831..1304318)
Genome map
AA seq 495 aa AA seqDB search
MLKHTKSKQPKLKYKPSTIISTMDYIFEEVRIKRSNAPRFVLNGEEVDIWDKELIDYHSK
SVSEYVREKLLEFEKRGLDPFEEIIGKEKEKEMVKTALMSGSNILFKGKKGYGKTTFSKA
ISKLLPDKILAIKGCRIHDDPTQPTCFSCKKKLLEEDEVELVFVPKKWIRIAGDPMMTTR
QLIGGISLQKIKEGYELDHPEVFTPGRILKAHRGIAYFDELGSIPSALQTLLHELLEERQ
VTTPEGDIVPMKIDTLVIASTNPANYKGVSDIKEPLLDRMEQIDIGPPESIEHEIAIGLR
NMALDGSIIPEWHLKIIASAVRCMRSSNCRYSARIEVEPSCRATIKAFDHVAASAMRNGR
KAVMFADYGRDFANLSLALKSRFEVDYEEELSKDEVVREVVNDAIDTVCGEIYAAIPRSI
FGGMMEELSEIGEINVYSENGIEKYKNLWAFVSSICRRREEVSSALEITLESVARCTGLL
ERREVGVYEYLAYDR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacacacgaaaagcaagcaaccaaaactgaaatataaaccttcaacaattatt
tcaacaatggactacatattcgaagaggtaagaataaaaagaagtaacgctcccaggttc
gttctcaacggcgaggaggttgacatctgggataaggagcttatagactaccactcgaag
agcgtttccgaatacgtgagggagaagctcctcgaatttgagaaaagaggtctcgaccca
tttgaagaaataataggaaaggagaaggagaaggaaatggtcaaaacagccctgatgagc
gggtcgaacatccttttcaaggggaaaaagggttacgggaaaacaaccttctcaaaggca
atttcaaagcttttacccgacaaaatcctcgccatcaaggggtgcagaattcacgacgac
ccgacgcagccgacgtgcttctcctgcaagaaaaagctcttggaagaggatgaggttgag
ctcgttttcgtcccgaagaagtggataaggatcgccggagacccaatgatgacgacgagg
cagctcatcggcggaatcagccttcagaaaataaaggagggctacgagctcgaccacccg
gaagtcttcactcccggaaggattctcaaggcacacaggggcatcgcatacttcgacgag
ctcggttcaatcccctcagctctccaaactctcctccacgagcttctcgaggagaggcag
gtcaccacacccgaaggagacatagtccccatgaaaatcgacacgctcgtcatagcatca
actaaccctgcaaactacaagggagtttcggacattaaggagccactcctcgacaggatg
gagcagatagacatcggccctcccgagagcatagagcacgagatagcgatagggctgaga
aacatggccttggatggctcaataattccagagtggcatctcaagataatcgcctctgcc
gtcagatgcatgaggagcagcaactgcagatactcggcaagaattgaggttgagccgagc
tgcagggcaacaataaaggcttttgatcacgttgccgcctcagccatgcgaaatggccgg
aaagcggtgatgttcgcggactatggaagagatttcgccaatctcagccttgctttaaag
agcaggtttgaggtggattacgaggaagagcttagcaaggacgaagtggtgagggaggtt
gtcaatgatgcaatcgataccgtctgcggggaaatctacgccgcaataccgagaagcata
ttcggcggaatgatggaggagctatctgaaattggggagattaacgtttactccgagaac
ggaattgaaaaatacaagaatctgtgggcttttgtgtcatcaatctgcaggagaagggag
gaggttagctcagcacttgaaatcacgcttgaatcagtagcgagatgtacgggcttgctg
gagagaagagaggttggagtttatgagtacctcgcctacgacagataa

DBGET integrated database retrieval system