KEGG   Archaeoglobus fulgidus DSM 4304: AF1540Help
Entry
AF1540            CDS       T00011                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF1540 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AF1540 (sucC)
   00640 Propanoate metabolism
    AF1540 (sucC)
   00660 C5-Branched dibasic acid metabolism
    AF1540 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF1540 (sucC)
Enzymes [BR:afu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AF1540 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388629..1389780)
Genome map
AA seq 383 aa AA seqDB search
MMRLHEHQAKQIFAKHGIRVPRGEVATSPEEAEKIAEKLGGRVVVKAQILVGGRGKAGGV
KKANSPEEAKEVAKKILGMTIKGHRVEKVLVEEQLNMRKEYYVGYVVDKSSRLPTVIFSR
MGGMDVEEIAAKHPDAIHRIYFDPLWGLKDYEVRKALFRAGFEGEEFKQMFDIIKKLVDI
AFAYEAELTEINPLAVTDEGFLAADARLNTDDNALYRHPELAELREATEEDPLEREARLK
GINYVHLGGNVGVIANGAGLAMATMDIINLMGGKPANFLDTGGGLADPVKMKNCLLHVLK
DPNVRVVFINIYAEITRCEKVAEGIILALDEAPRKVPLVVKLAGTNEEIGREMLERYSSE
KGAEIHFVESIEEGARKAVELAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccttcacgagcatcaggcaaagcagatatttgcaaagcacggaattagggtt
ccgcggggcgaggttgctacatcacctgaagaggcggagaaaattgcggaaaaacttgga
ggcagggttgtggttaaggcccagattttggttggtggaaggggcaaggcggggggtgtt
aagaaggcaaacagcccggaagaggcaaaggaagtggcaaagaagattctcggcatgacc
atcaaagggcacagggttgagaaagtgcttgtggaggagcagctcaatatgagaaaggag
tactacgtgggctacgtcgttgacaagtcgagcaggctccccacagtgattttcagtcgg
atgggaggtatggatgtggaggaaatagctgcgaagcaccccgatgcaatacacaggatt
tacttcgaccccctttgggggctgaaggattacgaggttcgcaaggctctgttcagagcc
ggctttgaaggagaggagttcaagcagatgtttgacataatcaaaaaacttgtcgatatc
gcatttgcctacgaagctgagctgacggagataaacccccttgcggtgacggatgaggga
tttttggctgccgacgcccgattgaacaccgatgacaacgccctctaccgccatccggag
cttgcagaactgagggaggcaacggaggaggacccgcttgagagggaggcgaggctgaaa
ggaatcaactacgtccaccttggcgggaatgtgggggtaattgcaaacggtgcgggcctt
gcaatggccacaatggacataatcaacctgatgggaggaaagccggcgaacttccttgat
accggaggaggcctggctgacccggttaaaatgaaaaattgcctccttcacgttctcaag
gacccgaatgtgagggttgttttcataaacatctacgcagagataacgaggtgtgaaaag
gttgctgaaggaatcattctggcactggacgaagctccgagaaaggttccgcttgtcgta
aagcttgcgggcacaaatgaggaaatcgggagggaaatgcttgagaggtacagttcggag
aagggggcggaaatccacttcgtggagtctattgaagagggagccagaaaggctgttgag
cttgcggggtga

DBGET integrated database retrieval system