KEGG   Archaeoglobus fulgidus DSM 4304: AF1599Help
Entry
AF1599            CDS       T00011                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF1599 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF1599 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AF1599 (trpA)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AF1599 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434885..1435631)
Genome map
AA seq 248 aa AA seqDB search
MIDRSLIVFFTACYPTAEKTVEFMLTAAESGADVIELGVPFSDPVADGKTIQESYVRALR
NFRVERVFEIAKAFRAESDKPLVLMSYYNPIYRRGVESFVEKAYSSGIDAMLVVDLPYDE
AGDFVEVCSRTGMKNVFLAAPNTPEDRLRAMDELSAFVYLVSTYGVTGERDRISPLAFEA
LKRAKGICRKPVAVGFGVSKADHVRQLISAGADGVVVGSAFVRLINEKGERATEDIRALT
ENLRSGLV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattgacaggtcgctgatagttttcttcacggcctgctatccaactgctgagaaaact
gttgagttcatgctcactgccgctgaatccggtgctgacgttatcgagcttggtgtgccc
ttcagcgacccggtggctgacggcaaaacaattcaggagtcctacgtcagggctctgagg
aacttcagggttgagcgggttttcgagattgcgaaggccttcagggctgagtcggacaaa
ccgctcgtgctgatgagctactacaatccaatctaccgcaggggtgtggagagctttgtg
gagaaagcctactcctcagggatagacgccatgctcgttgttgacttgccctacgacgag
gccggagactttgtggaggtttgcagcagaactgggatgaagaacgtttttctggctgct
ccaaacacgcctgaagataggctgagggcgatggacgagctttcagctttcgtttatctg
gtttcgacctacggtgttacgggagagagggacagaatctccccgcttgcctttgaagcg
ctgaagagggctaagggcatctgcaggaagccagtagctgtcggatttggggtgtcaaag
gccgatcatgtgagacagctaatcagcgcgggggcggatggggttgttgttggaagcgcc
tttgttcggctgataaatgagaaaggggagcgtgcaactgaggacataagggctctgaca
gagaacctgagaagcggtttggtttga

DBGET integrated database retrieval system