KEGG   Archaeoglobus fulgidus DSM 4304: AF1600Help
Entry
AF1600            CDS       T00011                                 

Gene name
trpB-2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AF1600 (trpB-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AF1600 (trpB-2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AF1600 (trpB-2)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AF1600 (trpB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435628..1436821)
Genome map
AA seq 397 aa AA seqDB search
MRCWLENLSGGRKMKFGEFGGRFVPEVLIPPLEELEKAYDRFKDDEEFKARLEYYLKSYA
GRPTPLYFAENLSRELGVKIYLKREDLLHGGAHKINNTIGQALLAKFMGKKRVIAETGAG
QHGVATAMAAALLGLEAEIYMGAEDYERQKMNVFRMELLGAKVTAVESGSRTLKDAINEA
LRDWVESFEHTHYLIGSVVGPHPFPTIVRDFQAVIGKEARRQIIEAEGGMPDAIIACVGG
GSNAMGIFHPFLNDDVRLIGVEAGGEGIESGRHSASLTAGSKGVLHGMLSYFLQDEEGMM
LDTHSVSAGLDYPGVGPEHAYLKETGRCEYVTVNDEEALRAFKTLSKLEGIIPALESAHA
IAYAMKMAEEMQRDDVLVVNLSGRGDKDMDIVRRRLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagatgctggttagagaatttgtcaggagggcgaaaaatgaagttcggtgagtttggc
ggaagatttgttccggaggttcttattccacctctggaggagcttgaaaaagcttatgac
aggtttaaggatgatgaggagttcaaagcaaggctggaatactacctcaaaagctacgcg
gggaggccaactcccctctactttgcagagaatctcagcagagagcttggagtgaaaatt
tacctgaagagggaggatttgcttcacggcggggcgcacaaaatcaacaacacaatcggc
caggctctgctggccaaattcatggggaagaagagggttatcgcagaaaccggcgctggg
cagcatggtgtggcaacggcaatggcggcagcccttcttggactggaggcggagatttac
atgggggctgaggattacgagaggcagaagatgaacgttttcaggatggagctgcttggg
gcgaaggttacagcagtagagagtggaagcagaacgctgaaggatgcgataaatgaggcc
cttcgggactgggttgagagcttcgagcacacccactacctcatcggctcggttgtgggg
ccacatcctttccccaccatcgtgagggactttcaggccgttatcgggaaggaggcgagg
aggcagattattgaggctgagggagggatgccggacgccatcatcgcctgcgttggaggg
ggcagcaacgccatgggaatcttccatcccttcctgaacgatgacgttaggctgataggt
gttgaggctggcggggaggggattgagagcggcaggcattcagcatcccttacagcggga
agtaagggtgtgcttcacggcatgctgtcctacttcctgcaggatgaggaggggatgatg
ctcgacacccacagcgtttctgccgggcttgactatcccggagttgggcctgagcatgcc
tacttgaaggagacagggaggtgtgagtacgtaacggtgaacgatgaggaggctttgaga
gcattcaagacgctttcaaagcttgaggggataattcccgccctggaatctgctcacgcc
attgcctacgcgatgaaaatggctgaggagatgcagagagacgacgttctggtggtgaac
ctttctggcagaggggataaggacatggacatcgtgaggaggaggttggcatga

DBGET integrated database retrieval system