KEGG   Archaeoglobus fulgidus: AF1700Help
Entry
AF1700            CDS       T00011                                 

Gene name
porD
Definition
pyruvate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
afu  Archaeoglobus fulgidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF1700 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF1700 (porD)
   00020 Citrate cycle (TCA cycle)
    AF1700 (porD)
   00620 Pyruvate metabolism
    AF1700 (porD)
   00640 Propanoate metabolism
    AF1700 (porD)
   00650 Butanoate metabolism
    AF1700 (porD)
  Energy metabolism
   00680 Methane metabolism
    AF1700 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AF1700 (porD)
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AF1700 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1522935..1523228
Genome map
AA seq 97 aa AA seqDB search
MKIKINLGAISEPMQSENLKTGDWGTHYPVVDKEKCTACKTCEQYCPDLCIEVKEFGDEK
YAVVNYNYCKGCGICASVCPFEAIKMELKDIFKFDAC
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaaatcaatttaggagcgatttcggaaccaatgcagtctgaaaacctcaaa
acgggcgactgggggacgcactatcctgtggttgacaaggaaaagtgcacagcctgcaaa
acatgcgagcagtactgccctgatctgtgcattgaggtcaaggagtttggggatgagaag
tatgcagttgtgaactacaactactgcaagggatgcggcatctgtgcctcagtctgcccc
tttgaggccattaagatggagctgaaggacatcttcaagtttgatgcttgctga

DBGET integrated database retrieval system