KEGG   Archaeoglobus fulgidus DSM 4304: AF1702Help
Entry
AF1702            CDS       T00011                                 

Gene name
porB
Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF1702 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF1702 (porB)
   00020 Citrate cycle (TCA cycle)
    AF1702 (porB)
   00620 Pyruvate metabolism
    AF1702 (porB)
   00640 Propanoate metabolism
    AF1702 (porB)
   00650 Butanoate metabolism
    AF1702 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF1702 (porB)
   00680 Methane metabolism
    AF1702 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AF1702 (porB)
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AF1702 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524410..1525294
Genome map
AA seq 294 aa AA seqDB search
MKYFGSGHGACPGCGLPIAVKTVLNLLDGKVFAVNSTGCLEIISSQYGKNAWNVPYIHSL
FENAAAVAAGVEAALRALKRKDEGHVVVFAGDGATADIGIGTLSGAFDRNHDILYICLDN
EAYQNTGHQQSGLTPPGESTTTTPAGKVLPGKVGRKKDMISIAVAHGIPYVASSSVGYVS
DIRRKVKKAVKFEGAKYIQIHSPCVTGWGIDGSIAIKVARLAVETGLYPLVEFEYGKLTS
VRKIKDRKPVEEYLKLQRRFRHLFTHEKGREMIETLQRFADENAERYGLDLKRE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacttcggcagcggacatggcgcttgccccggatgcggtttgccgattgcagtc
aagaccgttctcaacttgcttgacggcaaggtcttcgcagtaaactccacaggctgcctc
gaaatcataagctcccagtacggcaagaatgcatggaacgtcccctacatccattctctc
tttgagaatgctgccgctgttgctgcaggagttgaggctgccctaagagccttgaaaagg
aaggatgaggggcatgtggtcgtttttgctggcgatggggcaacagcggacatcggcatt
ggaacgctgagcggagccttcgacaggaaccacgacatcctctacatctgccttgacaat
gaggcttaccagaacacggggcaccagcagagcggcttaacaccacccggagagtccacc
accacaacacccgcaggaaaggttctgccgggcaaggtggggaggaagaaggacatgatt
tctattgcggtagctcacggcatcccctacgttgcctcatcctcagtcggctacgtttcg
gacatccgcaggaaggtcaagaaggctgttaagtttgagggggccaagtacatccagatt
cactctccctgcgtcacgggatggggaattgacggcagcatcgcaataaaggtagcgagg
cttgcggttgagactggcctgtatcccctcgtcgagttcgagtacgggaagctgacttcg
gtgaggaaaattaaggacaggaagcctgttgaggagtacctgaagctgcaaaggaggttc
aggcacctcttcacccacgaaaagggcagggagatgattgagacactgcagagatttgcg
gacgagaatgcggagaggtacgggcttgatttgaagagggaatga

DBGET integrated database retrieval system