KEGG   Archaeoglobus fulgidus: AF1795Help
Entry
AF1795            CDS       T00011                                 

Gene name
celM
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afu  Archaeoglobus fulgidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AF1795 (celM)
Enzymes [BR:afu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     AF1795 (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1611371..1612285)
Genome map
AA seq 304 aa AA seqDB search
MGNLICTKNGGEPEIMVAAHMDEIGFAVKYIDDKGFIRIAPIGGWFSQIALAQRVVLYGK
KKVYGVIGCKPPHLMKDEERKKGIEIKDMFVDIGASSKEEVLEMGINVGTPVALDREIVE
LANGRITGKAFDNRVGVAVMIEAVRRAKADITIHAVATVQEEVGLKGARTSAFAIEPTAA
IAVDTCVAADFPGSESAHMDVKLGKGAAITVIDASGRGLIASPKVLRWLTETAEKYGIPY
QLEVAEGGTTDATAIHLTKAGIPAGVVSVPARYIHSPVEVVDLKDVESAVEIVARAIENA
KNYF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatctgatctgcacaaagaatggaggagagccggagataatggttgcagcgcac
atggacgagattggctttgccgtgaagtacattgatgataaggggttcatcaggattgct
ccgatcggcgggtggttttcccagattgctttagctcagagagtcgttttgtacggaaaa
aagaaggtttacggtgttatcggctgcaagcctccccacctgatgaaggatgaagagagg
aagaagggaatcgagataaaggacatgttcgtcgatatcggggctagcagcaaggaggaa
gtgcttgagatgggcatcaacgtaggcactcccgttgcccttgacagagagatcgtggag
ctggcaaatggcagaataacgggcaaagccttcgacaacagggttggtgttgcggtgatg
atcgaggcggtgagaagggcaaaggctgacatcaccatccacgcggtcgcgacggttcag
gaggaggtcggtttgaagggggctagaacttcggccttcgccatcgagcccacagccgca
attgcagttgacacctgcgtcgctgcagactttcccggcagcgagtcggcgcacatggac
gtcaagctcggtaagggagcggcaatcacagtcatagacgcatcggggagggggttgatt
gcctctccaaaggttttgaggtggctgaccgagacagctgaaaaatacggcatcccctat
cagcttgaggttgctgagggcggaaccaccgatgcaactgcaattcacctcacaaaggcc
ggaattccagcaggggttgtcagcgtgcctgcaagatacattcacagccctgtggaggtt
gttgacttgaaggacgttgagagcgctgtagagattgtggcaagagcaatcgagaacgcc
aaaaactacttctga

DBGET integrated database retrieval system