KEGG   Archaeoglobus fulgidus: AF1795Help
Entry
AF1795            CDS       T00011                                 

Gene name
celM
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afu  Archaeoglobus fulgidus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1611371..1612285)
Genome map
AA seq 304 aa AA seqDB search
MGNLICTKNGGEPEIMVAAHMDEIGFAVKYIDDKGFIRIAPIGGWFSQIALAQRVVLYGK
KKVYGVIGCKPPHLMKDEERKKGIEIKDMFVDIGASSKEEVLEMGINVGTPVALDREIVE
LANGRITGKAFDNRVGVAVMIEAVRRAKADITIHAVATVQEEVGLKGARTSAFAIEPTAA
IAVDTCVAADFPGSESAHMDVKLGKGAAITVIDASGRGLIASPKVLRWLTETAEKYGIPY
QLEVAEGGTTDATAIHLTKAGIPAGVVSVPARYIHSPVEVVDLKDVESAVEIVARAIENA
KNYF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatctgatctgcacaaagaatggaggagagccggagataatggttgcagcgcac
atggacgagattggctttgccgtgaagtacattgatgataaggggttcatcaggattgct
ccgatcggcgggtggttttcccagattgctttagctcagagagtcgttttgtacggaaaa
aagaaggtttacggtgttatcggctgcaagcctccccacctgatgaaggatgaagagagg
aagaagggaatcgagataaaggacatgttcgtcgatatcggggctagcagcaaggaggaa
gtgcttgagatgggcatcaacgtaggcactcccgttgcccttgacagagagatcgtggag
ctggcaaatggcagaataacgggcaaagccttcgacaacagggttggtgttgcggtgatg
atcgaggcggtgagaagggcaaaggctgacatcaccatccacgcggtcgcgacggttcag
gaggaggtcggtttgaagggggctagaacttcggccttcgccatcgagcccacagccgca
attgcagttgacacctgcgtcgctgcagactttcccggcagcgagtcggcgcacatggac
gtcaagctcggtaagggagcggcaatcacagtcatagacgcatcggggagggggttgatt
gcctctccaaaggttttgaggtggctgaccgagacagctgaaaaatacggcatcccctat
cagcttgaggttgctgagggcggaaccaccgatgcaactgcaattcacctcacaaaggcc
ggaattccagcaggggttgtcagcgtgcctgcaagatacattcacagccctgtggaggtt
gttgacttgaaggacgttgagagcgctgtagagattgtggcaagagcaatcgagaacgcc
aaaaactacttctga

DBGET integrated database retrieval system