KEGG   Archaeoglobus fulgidus DSM 4304: AF1974Help
Entry
AF1974            CDS       T00011                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AF1974 (hemB)
Enzymes [BR:afu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AF1974 (hemB)
Exosome [BR:afu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AF1974 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774587..1775555)
Genome map
AA seq 322 aa AA seqDB search
MAEFPKVRMRRLRKANLRWMFREARLSPENLITPIFVDENIKEKKPIESMPDYFRIPLEM
VDKEVEECLEKDLRSFILFGIPSYKDETGSSAYDQNGVIQKAVRRIKAEFPDAVIVTDVC
LCEYTTHGHCGVVKDGEIVNDETLPIIGKTAVSHAESGADIVAPSGMMDGMVKAIREALD
AAGFESTPIMSYSAKYASNFYSPFRDAAESGFKFGDRRGYQMDIHNAREAMREIELDVKE
GADIIMVKPALPYLDIIRMVRERFDLPLAAYNVSGEYSMIKAAIKNGWLSEEAIYEVLIS
IKRAGADLIITYHSKEIAEKLQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtttccgaaggtaaggatgcgaaggttgaggaaggcaaacctgaggtggatg
ttcagagaagcaaggctgagtcctgagaatctcataacaccgattttcgttgatgaaaat
attaaagaaaagaagccgatcgaatccatgcctgactacttcagaattccgctggagatg
gttgataaggaggttgaggagtgcctcgagaaggacctgagaagcttcatcctttttggc
atcccctcctataaggacgaaactggttcttctgcttatgaccaaaatggtgtaatacag
aaagccgtcaggcgaattaaggctgagtttccggatgctgtaatcgtaacggacgtctgc
ctctgcgagtacacaactcacggccactgcggtgttgtaaaggatggggagattgtgaat
gatgagacattgcccataatcgggaaaactgctgtgagccatgcggaaagcggagcggac
attgttgcgccatccggaatgatggatggaatggttaaggcgataagagaggcccttgat
gcagcgggttttgagagcactcccattatgagctactccgccaagtatgcttccaacttc
tactctcccttcagagatgctgcggagagcgggttcaagtttggtgacagaagggggtat
cagatggatatccacaatgccagagaggcgatgagggagatcgagcttgatgtcaaagag
ggagcggacataatcatggtcaagccggccctgccctacctcgacattataagaatggta
cgggagcgcttcgatttgcctttggcagcgtacaacgtgagcggagagtacagcatgatc
aaagctgcgataaagaacggctggctgagcgaggaggcaatctacgaggttctgatttcc
ataaaaagggctggagcggacctcatcataacctaccactccaaggaaattgccgagaag
cttcagtaa

DBGET integrated database retrieval system