KEGG   Archaeoglobus fulgidus DSM 4304: AF2052Help
Entry
AF2052            CDS       T00011                                 

Gene name
vorB
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF2052 (vorB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF2052 (vorB)
   00020 Citrate cycle (TCA cycle)
    AF2052 (vorB)
   00620 Pyruvate metabolism
    AF2052 (vorB)
   00640 Propanoate metabolism
    AF2052 (vorB)
   00650 Butanoate metabolism
    AF2052 (vorB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF2052 (vorB)
   00680 Methane metabolism
    AF2052 (vorB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AF2052 (vorB)
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AF2052 (vorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850576..1851412)
Genome map
AA seq 278 aa AA seqDB search
MILPGNASCQGCPISMAMRCLDEIENPVLVIPAGCSTVIAGLHPKSAMKCPVVHVPFAST
HSVACGLSEAYKKLGVGATVVAWMGDGAADIGFAALSASATRKDDILTVVVDNEAYMNTG
TQSSLSTFWKAKTTTSPKGKTEDRRNLALVMLAHKVDYVATASVGYIHDLRRKFRIAGKK
DGFRFLHVHAPCPPGWRFPSEKTVEVARKAVMSGAWILWEYDGKLTLSPPSRKYADGSER
IPLEEYLSQGRFQHLSREDIEEIERRIEEEWKLLLKFS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattctgccgggaaacgcaagctgccagggatgccccatatcgatggcgatgcgctgc
ttagacgagatagagaatccagttctcgtaattccagccggctgctcgacggtgattgcc
ggcctgcatccaaagtccgctatgaaatgccccgtagtgcacgttcccttcgcatccacc
cactccgttgcatgcgggctcagcgaggcttacaagaaactcggagttggtgctactgtt
gttgcctggatgggggatggtgctgcagacatcggctttgctgctctaagcgcttcggca
acgcggaaggatgatattctcactgttgttgttgacaatgaggcgtacatgaacaccggg
actcagtcgagcctcagcaccttctggaaggcgaaaacaacaacttcccctaaagggaaa
actgaggacaggaggaacctcgcactggtgatgctggctcacaaggtcgactatgttgct
acagcctcggtcggctacattcacgatttgaggaggaagttcaggattgcgggtaaaaag
gatggtttcaggtttttgcacgtccacgctccttgccctccgggctggagatttcccagc
gagaagacggttgaggttgcgagaaaagccgtgatgagtggagcctggattctctgggag
tacgacggtaagcttactctctccccaccgagcaggaagtacgcagatgggtcggaaagg
ataccgctggaggagtacctcagtcagggtaggtttcagcatctgagcagagaggacata
gaggagatagagaggaggatagaggaggagtggaagctgctcctcaaattttcctga

DBGET integrated database retrieval system